KEGG   Mus musculus (mouse): 106722
Entry
106722            CDS       T01002                                 

Gene name
Mpig6b, AU02387, AU023871, C6orf25, G6b, Ng31
Definition
(RefSeq) megakaryocyte and platelet inhibitory receptor G6b
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: G6B
Other DBs
NCBI-GeneID: 106722
NCBI-ProteinID: NP_001177941
MGI: 2146995
Ensembl: ENSMUSG00000073414
Vega: OTTMUSG00000014959
UniProt: D7PDD4
Position
17; 17 B1
AA seq 242 aa
MALVLPLLPLLLSKVQGNPEVSLEGSPGDRVNLSCIGVSDPTRWAWAPSFPACKGLSKGR
RPILWASTRGTPTVLQHFSGRLRSLDNGIKRLELLLSAGDSGTFFCKGRHENESRTVLQV
LGDKAGCRPAGSTHGYEYPKVLIPLLGVGLVLGLGVAGVVWRRRRLSPPPPPPPPPGPLP
TFAPVINAEPQRPLEQESKISGHLDQEPSLHYADLDHSVLGRHRRMSTVVSGDASTVYAV
VV
NT seq 729 nt   +upstreamnt  +downstreamnt
atggccttggtcctgccgctgctgcctttgttgctctcaaaggtccaggggaatcccgag
gtttctttggagggcagccctggggaccgggtgaatctctcctgcataggggtctccgac
cccacccgctgggcttgggcgcctagtttcccagcatgcaagggcttgtctaaagggcgc
cgtccgatcttgtgggcctcgacgagagggaccccaactgtgctccagcatttctctggc
cgcctgcgttccctggacaatggtatcaagcggctagagctgctgctgagcgccggggat
tctggaacctttttctgcaaaggacgccacgagaatgagagtcgcacagtgcttcaagtg
ttaggggacaaggcaggttgccggcctgcaggatctacccacgggtacgagtatcccaag
gtcctgattccgctcctgggcgttgggcttgtgctgggactgggagtcgcgggcgtggtc
tggcggcggcgcagactctcgcctccgcccccacccccgcccccgcctggaccactaccc
acatttgctccagtcataaatgctgagccacagaggcctttagaacaggagtccaagatc
tcaggccacctggaccaggagccgagcctgcactacgctgatctggaccactctgtcctc
gggaggcaccgccggatgtccacagtggtttctggtgatgcctccactgtctatgcggtt
gtagtataa

DBGET integrated database retrieval system