KEGG   Mus musculus (mouse): 106795
Entry
106795            CDS       T01002                                 

Symbol
Tcf19, 5730403J10Rik, AW495861
Name
(RefSeq) transcription factor 19
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-GeneID: 106795
NCBI-ProteinID: NP_001157235
MGI: 103180
Ensembl: ENSMUSG00000050410
Vega: OTTMUSG00000034281
UniProt: Q99KJ5 G3XA31
Position
17; 17 B1
AA seq 263 aa
MLPCFQLLRIGGGRGGDLYTFHPPSKSGCTYRLGCRADLCDVALRPQQEPGLISGVHAEL
HAELQGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPQGQAGTSSSSEFYF
MFQQVRVKPQDFAAITVPRSKGEAGGGFQPMLPPQGAPQRPLSTLSSAPKATLILNSIGS
LSKLQAQPLTFSRGGGRPQGLAIPSQHGEAQVSPAPPTRNRRKSAHKVLAELDDEVSPGP
LSVLTEPRKRLRVEKAALIASGE
NT seq 792 nt   +upstreamnt  +downstreamnt
atgctgccctgtttccagctgctgcgtatagggggcggcaggggcggtgacctctacacc
ttccaccccccgtccaagtctggctgcacctatcgattgggctgcagggccgacctgtgt
gatgtggccctgcggccccagcaggagcccggcctcatctctggagtccatgcggaattg
catgctgaactccaaggggacgactggagggtcagcctggaggatcacagcagccaaggg
actttggtcaataatgtccgacttccaagaggccacagactggagttgagtgatggtgac
cttctgacctttggcccccaaggtcaagcaggaaccagctcctcctcagagttctacttc
atgtttcaacaagtccgggttaaacctcaggactttgcagccataaccgtccctcggtct
aagggagaagctgggggcggtttccaacctatgctgcccccccaaggggcacctcagagg
ccactcagcactctctcctctgcccccaaggccacactgattctcaattccatcggcagc
ctcagcaaactccaggcccagcctctcaccttctcccgtggtggtggcaggccacagggc
ctggctattccctctcagcatggggaagcgcaagtttcgcctgctccacccacaagaaac
cggaggaaatcagctcataaagtgttggcagagctagatgatgaggtctccccaggcccc
ctgtccgtcctgacggagcccaggaagaggctccgggtggagaaagctgctctgatagcc
agtggggaatga

DBGET integrated database retrieval system