KEGG   Mus musculus (mouse): 106878Help
Entry
106878            CDS       T01002                                 

Gene name
Smim3, 2010002N04Rik, AI195350, AW561905, Nid67, cI-41
Definition
(RefSeq) small integral membrane protein 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Smim3 Epiglycanin_C DUF4305 Renin_r
Motif
Other DBs
NCBI-GeneID: 106878
NCBI-ProteinID: NP_598894
MGI: 1917088
Ensembl: ENSMUSG00000038059
UniProt: Q99PE5 Q3U1M0
Position
18; 18 D3
AA seq 60 aa AA seqDB search
MDAITQSPVDAVLPKHILDIWAIVLIILATIVIMTSLFLCPATAVIIYRMRTHPVLNGAA
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atggacgctatcacccaatcccctgtggatgccgtgcttcccaagcacatcctggatatc
tgggccatagtcctcatcatcctggctaccattgtcatcatgacctccttgtttctgtgc
ccggccactgcggtcatcatctatcgaatgcggactcacccagttctcaacggggctgcc
tga

DBGET integrated database retrieval system