KEGG   Mus musculus (mouse): 107022
Entry
107022            CDS       T01002                                 

Gene name
Gramd3, 9030613F08Rik, 9130427A09Rik, AW061306, Gramd2b, NS3TP2
Definition
(RefSeq) GRAM domain containing 3
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: GRAM 7TM_GPCR_Srd DUF5846
Other DBs
NCBI-GeneID: 107022
NCBI-ProteinID: NP_001347846
MGI: 1914815
Ensembl: ENSMUSG00000001700
Position
18; 18 D3
AA seq 445 aa
MVKKRLSSSDNVFKFEIPSNSKTSAEAPHSSTDSPSSVFLSSEAENGAEDRRRVSKSPTA
QSPTSSVEAESPDQKRSLGLWSKSSFDGSSLLSDKNDCKTESKTDSKTERKKSSSSSQYK
ANMHFHKLFLDVPTEEPLRQSFTCALQKEILYQGKLFVSENWICFHSKVFGKDTKISIPA
FSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKLIKSVCGHLENTSVGNSPN
PSSAENSFRADRPSSLPLDFNDEFSDLDGVVRQRRQDLEGYSSSGSQTPESENSRDFHVT
ESQTVLNVTKGETKPPRTDAHGSRAPDGKAKILPAHGQSETIGILHKMESRKCPTLHHIL
IVYAIIVCALIISTFYMRYRINTLEERLGTLTSIMDPHSTEQTAPSGLGSQMQLNVEVLC
QELTANIVKLEKIQNNLQKLLENGD
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggtgaagaaacggctttcctccagtgacaatgtgttcaagttcgagatccccagcaac
tcgaagaccagtgctgaggccccacacagctccactgacagcccaagctccgtgtttctc
agctcagaggctgagaatggtgcggaggacagaaggagggtcagcaagtcgccaacagcc
caatctcctacctcatctgtggaggccgagtccccggaccagaagaggagccttggcctg
tggtcaaaatccagttttgatggttccagtttgttgagtgataagaatgactgtaaaact
gaaagcaagactgactctaagaccgaaagaaaaaagtcttcatcgtctagtcagtacaag
gcgaacatgcactttcacaagttattcctggatgtcccaactgaggagccactgaggcaa
agctttacctgtgctcttcagaaagaaattctgtaccaaggaaagctctttgtgtcggaa
aactggatttgttttcattccaaggtctttggaaaagacactaagatctccattccagct
ttctcggtaaccttgatcaagaaaaccaaaactgcccttctggtgccaaacgccctgatc
atcgcgacggtcacagacaggtacatattcgtttccttgctgtccagagactcaacctac
aaactgataaaatctgtgtgcggacacttagagaacacaagtgttggtaacagtcccaac
ccatcttctgctgaaaacagtttccgggcagatcgcccttcgtctctgcctctggatttc
aatgatgaattctcagacctggacggagtggttcgacaacgaaggcaagacttggaagga
tacagcagctcaggatcccagactccggaatctgagaactcccgagacttccacgtgacc
gaatctcagacagttctgaatgtcacaaagggagaaacaaaaccacctcggacagatgcc
cacgggagcagagcacctgatggaaaagccaagatcctgcctgcccatggtcaatcagaa
actattggaattttacataaaatggagtctcggaagtgcccgactctccatcacatcctg
atagtctatgcaattattgtctgtgccctgatcatctccaccttctacatgagatacagg
attaacactctggaggagcgcctggggaccctgacgtccatcatggatccccacagtact
gagcagacagccccatccggcctgggatcacaaatgcagttaaatgtggaggtcctctgc
caagaacttacagctaacatagtgaaattggaaaagatacaaaacaacttacaaaagctg
cttgagaatggtgactga

DBGET integrated database retrieval system