KEGG   Mus musculus (mouse): 107035
Entry
107035            CDS       T01002                                 

Symbol
Fbxo38, 6030410I24Rik, AU044865, AW214031, Moka, SP3, SP329
Name
(RefSeq) F-box protein 38
  KO
K10313  F-box protein 38
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    107035 (Fbxo38)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     107035 (Fbxo38)
SSDB
Motif
Pfam: F-box F-box-like
Other DBs
NCBI-GeneID: 107035
NCBI-ProteinID: NP_598897
MGI: 2444639
Ensembl: ENSMUSG00000042211
UniProt: Q8BMI0
Position
18; 18 E1
AA seq 1194 aa
MGPRKKSAKVCVMDSEVAEEMTADEEKDYMNQLSHEVLCHIFRYLPLQDIMCMECLSRKL
KEAVTLYLRVVRVVDLCAGRWWEYMPSGFTDSSFLTLLKKMPDVEQLYGLHPRYLERRRV
RGQEAFSIPGVLEALQACPNLVGVETSHLELVESIWTYMPHVHILGKFRNRNGAFPIPPE
NKLKIPIGAKIQTLHLVGVNVPEIPCIPMLRHLYMKWVRLTKPQPFKDFLCISLRTFVMR
NCAGPTNSLKYVPLVTGLASARNLEHLEMVRVPFLGGLIQHVVEDSWRSGGFRNLHTIVL
GACKNALEVDLGYLIITAARRLHEVRIQPSLTKDGVFSALKMAELEFPQFETLHLGYVDE
FLLQSRMANADLVKYGLADVVENPGIITDIGMKAVNEVFSCIKYLAIYNCPHLHNPYNWI
SDHSRWMRLVDINLVRCHALKLDSFGQFVELLPSLEFISLDQMFREPPKGCARVGLSAGT
GIGVSSALVSNQNSNNDNDNNAPNNNANLHDNNHHHPDDSDDDNDFRPDLQAGEAQFAAD
ALNEMEDMVQEDGELVAESGNGMPAHNREVLPVDADEEQAGPSGLQRVVKPTPIADHDSE
SDDEEDSLELQEVWAPKNGTRRYSEREEKTGDSGQSRETAVSGKGKTPLRKRCNNSHQTG
QAKPFPLEESSCEKGCQVTSEQIKADMKAARDVSEKKKSKDVYPSCSSSSSSTAASTAGN
ASSPSTASQSPDFARTVTSSGSSEPSPPEVDVSRQCVCSPGGSEDSEAMEEGDAESSVCP
RCCCLRPQESQRRTGRCSDEERPSTSRACVVNGADGTRSAFSFRTLPQGGSSGPAHDERT
NGSGCGATGEDRRGSSQPESCDVQSNEDYPRRPLTRARSRLSHVPLISESEVAKTKPCHA
MKRKRTADKSTSTSDPVIEDDHVQVLVLKSKNLVGVTMTNCGITDLVLKDCPKMMFIHAT
RCRVLKHLKVENAPIVNRFDYAQCKKLNMDQVLDQILRMPPERNRIIYLRPMQQVDTLTL
EQKLFSGPYPYHICIIHEFSNPPNVRNKVRIRNWMDTIANINQELIKYEFFLEATRTEED
LKKYPKYPWGREIYTLEGVVDGAPYSMISDFPWLRSLRTAEPNSFARYDFEDDEESTIYA
PRRKGQLSADICMETIGEEISEMRQMKRGIFQRVVAIFIHYCDVNGEPVEDDYI
NT seq 3585 nt   +upstreamnt  +downstreamnt
atgggaccacgaaagaaaagtgctaaagtgtgtgtgatggacagtgaggtcgctgaggaa
atgacagccgatgaagagaaggactacatgaaccagctgtcacatgaagtgctctgtcat
atcttcaggtacctgccactacaggacatcatgtgcatggaatgcctctctcggaagcta
aaggaggcagtcactctgtatctgagagttgtcagagtggtggatctctgtgcagggcgc
tggtgggaatatatgccaagtggcttcacagattccagtttcctaacccttttgaagaag
atgccagatgttgaacagctgtatggccttcaccctagatacctcgagaggcgaagagtg
aggggccaggaggctttcagcatcccaggagtcttggaagctttgcaagcgtgcccaaac
ttggtgggtgtagaaacatctcatttggagttggtagaatccatttggacatatatgccg
catgttcatattttggggaaatttcgtaatcgtaacggagcatttccgattcctcctgaa
aataaactgaaaatccccataggagccaaaatccaaactttgcatttagttggtgtcaat
gttcctgaaatcccttgtatccctatgctaaggcacctgtacatgaagtgggtgagactc
actaaaccacagccgtttaaagatttcctttgcatcagcttgcgaacttttgtcatgagg
aactgtgcaggaccaacaaactccttgaaatacgtgcccttggtaacaggtctggcatct
gcccgtaacctggaacacttggaaatggttcgagtccctttcctgggaggtctcatccaa
cacgtggttgaagacagctggagatcaggtggttttaggaacttgcacactattgtctta
ggagcttgcaagaatgccctggaagtagaccttggctacctcatcatcactgctgcgcga
aggttacatgaagttcgcatccagccttctttaaccaaagatggtgtcttttctgcccta
aagatggcagaattggagtttccccagtttgaaacccttcatctgggatatgtagatgag
ttcttgctacagagcagaatggcgaatgcagatttggtgaagtatggcttggctgatgtg
gtagaaaatcctggtatcattactgatatagggatgaaggcagtcaatgaagttttttcc
tgtatcaaatatctggcaatttataactgtcctcatctacacaacccatacaattggatc
tcagaccactcgaggtggatgcgactggttgatatcaacctcgtgcggtgccatgctttg
aagctggattcttttggccagtttgttgaattattgcccagcctggaatttatttctctg
gaccagatgttccgtgagccacccaagggctgtgctcgagttggtctgagtgcaggaact
ggaattggggtttcctcagcgcttgtcagcaaccagaattccaacaatgacaatgacaat
aatgctccaaataacaacgccaacctccatgataacaatcaccatcacccagatgattcg
gatgacgacaatgactttcgtccagacctacaagcaggagaggcacaatttgcagccgat
gcgttgaatgagatggaagacatggtccaggaagatggagaactggtagccgagagtgga
aatggtatgccagctcacaatcgggaagttcttcctgtggatgctgatgaggaacaagca
ggacctagtggtctacaacgcgtggtaaaacctacaccaattgctgatcacgattcagag
agcgatgatgaagaagatagtttagaactccaagaagtctgggctcctaagaatggcacc
cggcgttactcagagcgggaagaaaagactggagactcaggacagtccagggaaacggca
gtaagtgggaaaggcaagactccacttcgaaagaggtgcaacaactcccaccagacgggc
caggcgaagccgtttcccctggaggagagcagctgtgagaaaggctgtcaggtgaccagt
gagcagatcaaagccgatatgaaagcagctagggatgtttctgaaaagaaaaaatccaag
gatgtctatcccagctgcagcagcagcagcagcagcacagccgccagcacagcgggaaac
gccagctcacccagcactgcttcccagagcccggactttgcaaggacggtgaccagcagc
ggctcttccgagccgagccctccagaagtagatgtatccaggcagtgtgtctgctcccct
ggtgggtcagaggactctgaggccatggaggagggagatgcagagagctctgtctgcccc
agatgctgctgtctcaggccccaggagtctcaaaggagaactggcaggtgttctgatgag
gagcgtccttcaaccagccgagcctgtgttgtgaatggcgcggatggtacgagatccgcc
ttttcctttaggactctgccacaaggggggtcttcaggcccagcacatgatgagaggact
aatgggagtggctgtggggctacaggtgaggacaggagggggagctcccagcctgagagt
tgtgacgtgcagtctaatgaagactatcctcggaggcccctaaccagggccaggagcaga
ctgtcccatgtaccgctgatatctgagtcagaagttgccaaaacaaagccatgccatgcc
atgaaacgaaagcgaactgcagataagtctaccagcaccagtgaccctgtgattgaagat
gaccacgtacaggttcttgtattaaaatccaaaaatcttgttggagtcacaatgaccaat
tgtggaatcacagatctagtactgaaagactgccccaagatgatgttcatccatgctacc
aggtgcagggtactgaagcatttaaaggtagaaaatgcaccaattgtaaaccgatttgac
tatgcacagtgcaagaaactaaatatggaccaggtactagaccaaatactgaggatgcct
ccggagaggaaccggatcatctacctgcgcccaatgcagcaggtagacacactaactctg
gagcagaagctcttcagcgggccctacccctatcacatctgcatcatccacgagttcagc
aatcctcccaacgtgcggaacaaggtgcgcatccgcaattggatggacacgatagccaac
atcaatcaagagctcattaaatacgaattcttcctggaagccactcggactgaagaggat
ttaaagaagtaccctaagtatccctgggggagagaaatctacactttagagggtgttgta
gatggagcgccgtattccatgatttccgacttcccttggctgaggtcactgcggaccgca
gagcccaacagctttgccagatatgattttgaagatgatgaagagagcaccatctatgct
cctcgaagaaaagggcagttgtctgcagacatttgtatggagacaataggagaggagatc
tcagagatgcgccagatgaagaggggcatatttcagcgagtagtagcgatttttatccac
tactgtgatgtcaatggagagccagttgaagacgactacatttaa

DBGET integrated database retrieval system