KEGG   Mus musculus (house mouse): 107047
Entry
107047            CDS       T01002                                 
Symbol
Psmg2, 1700017I17Rik, AW545363, Clast3, Tnfsf5ip1
Name
(RefSeq) proteasome (prosome, macropain) assembly chaperone 2
  KO
K11876  proteasome assembly chaperone 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    107047 (Psmg2)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Assembling chaperones
    107047 (Psmg2)
SSDB
Motif
Pfam: PAC2
Other DBs
NCBI-GeneID: 107047
NCBI-ProteinID: NP_598899
MGI: 1922901
Ensembl: ENSMUSG00000024537
UniProt: Q9EST4
Position
18:67774657..67787251
AA seq 264 aa
MFVPCGESVPDLTNFTLLMPAVSVGNVGQLAIDLIISTLNMCKIGYFYTDCLVPMVGNNP
YATEEENSNELSINTEVYSLPSKKLVVLQLRSIFIKYKSKSFCEKLLAWVESSGCARIIV
LSSSHSYHRNDAQLRSTPFRYLLTPCLQKSVQNKIKSLNWLEMEKSRCIPEMSDSEFCIR
IPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDAVSLVEYLNEWLQIIKPCNDGPMA
SALPWKIPSSWRLLFGSGLPPALF
NT seq 795 nt   +upstreamnt  +downstreamnt
atgttcgttccctgcggggagtcggtccccgacctaacgaactttacactcctgatgcca
gcagtatccgttggaaatgttggccagcttgcaatagatctgattatttctacactgaac
atgtgtaagattggttatttctatactgattgcctggtgccaatggttggaaacaatcca
tatgcaactgaagaagaaaattcaaatgagctcagtataaatactgaagtgtattcctta
ccgtcaaagaagctagtggtgcttcagttaaggtccatctttattaagtacaaatcgaag
tcattctgtgaaaagctgctggcctgggtggaaagcagcggctgtgccaggatcattgtt
ctctcaagcagccattcgtatcaccgcaacgatgcccagctgcgcagtactcccttccgg
tatctgcttacaccttgtttgcaaaagagtgttcagaataaaataaagagcctgaactgg
ctagaaatggaaaagagtcggtgcatccctgagatgagcgattctgagttttgtattcgc
attcctggaggtggaatcacaaaaacgctctatgacgaaagctgttctaaagagatccag
atggcagttctgctaaaatttgtttcagaaggggacaatatcccagatgccgtcagcctt
gtggagtaccttaatgaatggcttcagataatcaaaccctgtaacgacggccccatggca
tctgccctgccttggaagatccccagctcttggcggctgctctttggcagtgggcttcct
cccgcgctgttttga

DBGET integrated database retrieval system