KEGG   Mus musculus (mouse): 107071Help
Entry
107071            CDS       T01002                                 

Gene name
Wdr74, 5730436H21Rik, AA407588
Definition
(RefSeq) WD repeat domain 74
  KO
K14841  ribosome biogenesis protein NSA1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    107071 (Wdr74)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    107071 (Wdr74)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 107071
NCBI-ProteinID: NP_598900
MGI: 2147427
Ensembl: ENSMUSG00000042729
Vega: OTTMUSG00000060351
UniProt: Q8VCG3
Position
19; 19 A
AA seq 384 aa AA seqDB search
MATASARWNHVWVGTETGILKGVNLQRKHAANFTPSGQPRREEAVNALCWGTGGETQILV
GCADRTVRYFNAEEGTFLSQRYCPGGEGTFRGLAQADGTLITCVDSGILRVWCENDKEAS
SDPLLELKVGPGVCRMRQDPTHTHVVATCGKENALKVWDLQGSEEPVFRAKNVRNDWLDL
RVPIWDQDTQFLPGSQKLVTCTGYHQVRVYDPVSPQRRPVLEATYGEYPLTAMTLTPEGN
SVIVGNTHGQLAEIDFRQGRLLGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIHRIRN
PRGLEHKVYLKSQLNCLLLSGRDNWEDEPQEPQEPNQVPSEDTETDELWASLEAAAKRKL
PDLDQTQGALQRRKKKKRPGSTSP
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgcctcggctcgctggaaccatgtgtgggtcggcactgagaccggcatcctg
aaaggggtgaaccttcagcggaaacatgcggcaaatttcacaccgtccggacagccgcgg
cgggaggaggcagtgaatgctctgtgctggggcactggcggcgagacccaaatcttggtg
ggctgtgcggacagaaccgtgaggtactttaatgctgaggagggtacattcctgagccag
agatactgcccaggcggggaaggcacgttccgaggtctcgcccaggcggatggcaccctt
atcacatgtgtggattctgggatcctcagagtctggtgtgaaaatgacaaagaggcgtcc
tctgacccactcttggaactgaaggtgggtcctggggtgtgtaggatgcgccaagatccc
acacatacacatgtggttgccacatgtgggaaagaaaatgctttgaaagtatgggaccta
caggggtctgaggagcctgtattcagggccaaaaatgtgcggaatgattggcttgatctc
cgagttcctatttgggaccaagatacacagttcctccctgggtcacagaaacttgtcaca
tgcacagggtaccaccaggtccgtgtctatgatccagtctccccccagcgccggccagtc
ctagaggccacctatggagagtacccactgacagctatgacccttactcctgagggcaat
tccgtcatcgtagggaacactcatgggcagctggcagaaattgattttcggcaagggcgt
ctactgggctgtctgaaggggcttgcaggtagtgttcgtgggctgcagtgtcacccttca
aagcccctattagcctcatgtggcttggacagagtcttgaggatacacaggatccgcaat
ccacgtgggctagagcataaggtttatctcaagtctcaactgaactgccttctcctgtca
ggccgggataactgggaggatgagccccaagaacctcaagagcccaaccaagtaccctca
gaagacacagagacagatgaactttgggcctctttggaggcagctgccaagcggaagctc
ccagatttggaccagacacaaggtgctctccaaagaaggaagaaaaagaagcggcctgga
tccaccagtccttga

DBGET integrated database retrieval system