KEGG   Mus musculus (mouse): 107182Help
Entry
107182            CDS       T01002                                 

Gene name
Btaf1, AI414500, AI447930, E430027O22Rik, TAF170
Definition
(RefSeq) B-TFIID TATA-box binding protein associated factor 1
  KO
K15192  TATA-binding protein-associated factor [EC:3.6.4.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    107182 (Btaf1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     107182 (Btaf1)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     107182 (Btaf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3535 SNF2_N HEAT Helicase_C Vac14_Fab1_bd HEAT_2 HEAT_EZ Cnd1 Rac1
Motif
Other DBs
NCBI-GeneID: 107182
NCBI-ProteinID: NP_001074175
MGI: 2147538
Ensembl: ENSMUSG00000040565
Vega: OTTMUSG00000042429
UniProt: E9QAE3
Position
19; 19 C2
AA seq 1848 aa AA seqDB search
MAVSRLDRLFILLDTGTTPVTRKAAAQQLGEVVKLHPHELNNLLSKVLIYLRSTNWDTRI
AAGQAVEAIVKNVPEWNPVPRTKQEPTESSMEDSSTTDRLNFDRFDICRLLQHGASLLGS
AGAEFEVQDEKSGEVDPKERIARQRKLLQKKLGLNMGEAIGMSTEELFNDEDLDYTPTSA
ALVNKQSTLQAAELIDSEFRAGMSNRQKNKAKRMAKLFAKQRSRDAVETNEKSNDSTDGE
PEEKRRKVANVVINQTASDSKVLIDNVPESSSLIEETNEWPLESFCEELCNDLFNPSWEV
RHGAGTGLREILKAHGKSGGKMGDSTLEEMIQQHQEWLEDLVIRLLCVFALDRFGDFVSD
EVVAPVRETCAQTLGVVLKHMNETGVHKTVDVLLKLLTQEQWEVRHGGLLGIKYALAVRQ
DVINTLLPKVLTRIIEGLQDLDDDVRAVAAASLVPVVESLVYLQTQKVPSIINTLWDSLL
ELDDLTASTNSIMTLLSSMLTYPQVQQCSIQQSLTVLVPRVWPFLHHTISSVRRAALETL
FTLLSTQDENSSSWLIPILSDMLRHIFQFCVLESSQEILDLIHKVWMELLSKASVQYLVA
AACPWMSAWLCLMMQPSHLPIDLNMLLEVKARAKEKTGGKVRQGQIQNKEVLQEYIAGAD
TIMEDPATRDFVVMRARMMAAKLLGALCCYICDPSVNMVNQEIKPADSLGQLLLFYLNSK
SALQRISVALVICEWAALQKECKAVTLAVQPRLLDILSEHLYYDEIAVPFTRMQNECKQF
ISSLADAHIEVGNRVNNNVLTIDQANDLVTTIFNEVTSTFDLNPQVLQQLDSKRHQVQMT
VAETNQEWQVLQLRVHTFAACAVVSLQQLPEKLNPIIKPLMETIKKEENTLVQNYAAQYI
AKLLQQCTTRTPCPNSKVIKNLCSSLCVDPYLTPCVTCPVPTQSGQENSKGSNSEKDGMH
HTVTKHRGIITLYRHQKAAFAITSRRGPIPKAIKAQIADLPAGSSGTILVELDEGQKPYL
VQRRGAEFALTTIVKHFGAEMAVKLPHLWDAMVGPLKSMIDLNNFDGKSLLERGDVPAQE
LVNSLQVFEIAAASMDSALHPLLVQHLPHLYMCLQYPSTAVRHMAARCIGVMSKIATMET
MNIFLEKVLPWLGAIDDNVKQEGAIEALACVMEQLDVGIVPYIVLLVVPVLGRMSDQTDS
VRFMATQCFATLIRLMPLEAGIPDPPNMSEELIQLKAKERHFLEQLLDGKKLENYKIPVP
INAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCQRAQEYARSKL
AECMPLPSLVVCPPTLTGHWVDEVGKFCSREYLNPLHYTGPPTERIRLQHQVKRHNLIVA
SYDVVRNDIDFFRNIKFNYCILDEGHVIKNGKTKLSKAVKQLTANYRIILSGTPIQNNVL
ELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLL
RRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVDETVSSAALSEETEKPK
LKATGHVFQALQYLRKLCNHPALVLTPQHPEFKSTTEKLTVQNSSLHDIQHAPKLSALKQ
LLLDCGLGNGSSTESGTESVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSI
PPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAH
RIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLD
KDGKAEKADSSTSGKASMKSVLENLSDLWDAEQYDSEYNLETFMRSLE
NT seq 5547 nt NT seq  +upstreamnt  +downstreamnt
atggcggtctccaggcttgatcgtctttttatcttactggatactggtactactccagtt
acaagaaaggctgctgcacagcaacttggagaagtggtgaagcttcatcctcatgaatta
aataatttgttatctaaggtattaatatatttaaggagtacaaattgggatacccggatt
gcagcaggacaagctgttgaagctatagtgaaaaacgtgcctgagtggaatccagtgcca
agaaccaaacaagaacctacagagagttctatggaagattcatctactacagatcgatta
aattttgacagatttgatatatgcagattgttacagcatggggcatcacttttggggtct
gctggtgcagaatttgaagtccaagatgaaaaatcaggtgaagtggatcctaaagagagg
atagcacgccaacggaaattattacagaagaaacttggacttaatatgggagaagcaatt
ggaatgagtactgaagaactcttcaacgatgaagatttggattataccccaacttcagca
gcccttgtaaacaaacaatctactctccaagcagctgaattgattgattcagaattccga
gcaggaatgagtaatagacagaagaacaaagctaaaagaatggccaagttatttgcaaaa
cagagatccagggatgcagtggaaacgaatgagaagagcaatgacagcactgatggagag
ccagaagaaaagagacggaaagtagcaaatgttgttattaatcagactgcaagtgattcc
aaagtcttgatagataatgttccagaaagttcttccttaattgaagagacaaatgaatgg
cctttggaaagcttttgtgaagaactttgcaatgacctttttaatccctcctgggaggtt
cgacatggggcaggtactggactcagagaaattcttaaagctcatgggaaaagtggtggt
aaaatgggagacagcactttagaggagatgattcagcagcatcaagagtggttggaagac
ttagtcattagactcctttgtgtttttgcgttggacagatttggagacttcgtttctgat
gaagttgtagcgccagttcgtgagacttgtgctcaaacgttaggtgtggttttaaagcac
atgaacgaaacaggagttcataagacagtggatgtgctgctgaaattattgacacaagaa
cagtgggaagttagacatggtggtcttctgggaataaaatatgctttggcagttcgtcag
gatgtaattaatactttattgcctaaagtcttaactcgaataatcgaaggactccaggac
cttgatgacgatgttagagctgttgctgcagcatccctggttcctgtagtagaaagcctt
gtctaccttcagacacaaaaggtaccctccattataaataccttatgggattctcttctg
gaattagatgatctaacagcttcaacaaatagtattatgactctcctttcatccatgtta
acttaccctcaggtccagcaatgcagtattcaacagtcactcacagttttagtcccacgt
gtctggccatttttgcatcacactatatcttcagttcgaagagcagcattggaaactctc
tttacattattatcaacacaggacgagaactcttcatcttggctcatacctatcctgtcg
gatatgctgagacacatttttcagttttgtgttttagaaagcagccaggaaattctggat
cttattcacaaggtttggatggagcttttgagcaaggcgtcagttcagtatttggtagca
gctgcatgcccatggatgagtgcttggctttgcctaatgatgcagccttctcacttacct
attgatttaaatatgctgctggaagtaaaagctagagccaaggaaaaaacaggtggtaag
gtacggcaaggtcaaatccagaataaagaagtgcttcaggagtatattgctggtgcagac
accatcatggaagacccagcgaccagagattttgtagttatgagggccaggatgatggca
gctaagttgttaggagcactctgttgctatatttgtgatccaagtgtaaatatggtaaac
caggaaattaaaccagcggattcccttggccagttactgctcttctatttgaattccaaa
tctgctttacagagaattagtgttgcgttagtaatctgtgagtgggctgctttacaaaag
gagtgtaaagctgttaccctagctgtgcaaccgcgtttacttgatatcctttcagaacat
ttgtattatgatgaaattgctgttccgttcacacgtatgcagaatgaatgtaaacagttt
atatcatcattagctgatgcacatattgaagttggtaatagagtaaacaacaatgtttta
acaatagatcaagcaaacgacctggtaaccactatttttaatgaagtcacatcaactttt
gatttaaatcctcaagtgttacagcagttagatagtaaacggcatcaggtccaaatgaca
gttgcagagacgaaccaggagtggcaagtactgcagctgagagtacacacgtttgctgcg
tgtgctgttgtgagcttgcagcagcttccggagaaactaaatcctatcataaaaccatta
atggaaacgattaaaaaagaagagaatacgctagtgcagaactatgctgctcagtacata
gctaagcttcttcagcagtgtacaacaaggacaccatgccctaattcaaaagttattaag
aacctctgtagctctctttgtgtggacccatacctcactccctgtgttacgtgtccagta
ccaacacaaagtggccaggaaaattctaaaggatccaactcagaaaaggatggaatgcac
catactgtcaccaagcacagggggatcattacactctacaggcatcagaaagcagcattt
gctatcaccagcaggcgaggtcccatccccaaagcaatcaaagctcagatagcagatcta
cctgcaggaagtagtgggactatcctggttgaacttgatgagggtcagaagccttacctg
gtacagcggagaggagctgaatttgccttaacaactatagtgaagcattttggtgctgaa
atggcagtgaagttgccacatctttgggatgctatggttggcccattgaagtctatgatt
gacctaaataattttgatggaaagtccctcctggaaagaggtgatgttcctgctcaagaa
ttggtgaattccctgcaagtgtttgaaatagcagcagcttccatggactctgcacttcat
cccttgctggtacagcacttgcctcatctttatatgtgccttcagtaccccagcactgca
gtgaggcacatggcggctcgttgcataggtgtcatgagtaaaatagctaccatggaaaca
atgaatatttttttggagaaggtacttccttggttgggagcaattgatgacaatgtcaag
caagaaggtgcaattgaagcacttgcctgtgttatggaacaattggatgtcggtattgtt
ccatatattgtccttttagttgttcctgtattgggaaggatgagtgatcagacagacagt
gtgagattcatggctactcagtgctttgcaacactgattagactgatgccacttgaggca
ggcattccagaccctccaaacatgtcagaagaattaatccagttgaaagcaaaagagcga
cactttttagagcaattgttagatgggaagaagttagaaaattacaagatcccagtgcca
atcaatgctgaactcaggaaatatcagcaggatggtgtgaactggttagcctttctcaat
aagtataagcttcatggaattctgtgtgatgacatgggcttaggaaaaacattacagtcc
atctgcattctagcaggagatcactgtcagagggcccaggaatatgcaagatcgaaattg
gcagaatgtatgccacttccttccttggtggtttgtccaccaacattaacaggtcattgg
gtagatgaagtaggtaaattttgttccagagaatatctcaatccgttgcattatactggc
cctcccactgaaaggataaggttgcaacatcaagtaaaaaggcacaatctgatagtagcc
tcatatgatgttgtgaggaatgacatagacttttttagaaatattaaatttaactactgt
attcttgatgaaggccatgtcataaaaaatggaaaaaccaagttgtccaaagcagtaaag
cagctgactgctaattacaggattattctttctggaacaccaatccagaacaatgttttg
gagttgtggtcattatttgatttccttatgcctggatttttgggtactgaacgccagttt
gctgctcgatatggcaaacctatattagcgagtagggatgcacgaagctccagtcgagaa
caagaagcaggtgtcctggcaatggacgctctgcaccgccaagtcctgccgttccttctc
agaagaatgaaagaagatgttttgcaggatcttccacctaaaattattcaagactattac
tgtactctcagccctctccaggttcagctttatgaagattttgctaagtcgcgtgccaag
tgtgatgttgatgagaccgtgtcttcagctgcactttcagaagaaactgaaaaaccaaaa
cttaaagcgacaggtcatgtattccaggcgttacaatatttacgtaagctctgcaaccat
ccagcactggtcttaacccctcagcatccagaattcaagagcactactgaaaaactgacc
gttcagaattcttctcttcatgatattcaacacgcgcctaagctctcagccttgaaacaa
ctgctgttggactgtggtttggggaatggcagttctacagagagtggcacagagtctgtt
gtggcacagcacagaatactgatcttctgtcagcttaaaagcatgcttgatatagtagaa
catgatctgctcaagcctcacctgccctctgtcacttacttgagactagatggcagcata
cctcctggacagcggcattccattgtttcccggtttaacaacgacccctccatcgatgtt
cttctactcacaactcacgttggtggcctgggcctgaacttgactggagctgacactgtg
gtgtttgtggagcatgactggaaccctatgcgagatctgcaggccatggaccgggcccat
cgtattgggcagaaacgtgtggttaatgtctaccggttgataaccagaggaacactagaa
gaaaagataatgggcttgcagaaattcaagatgaacatcgcaaatactgttattagccaa
gaaaactctagcttacagagtatgggcactgatcaacttcttgacctgttcactctagat
aaggatggaaaagcagaaaaggctgacagctccacttctgggaaagcaagcatgaaatca
gttcttgagaacctgagtgacctctgggacgccgagcagtatgattcggagtacaacctg
gagaccttcatgcgctctctcgagtga

DBGET integrated database retrieval system