KEGG   Mus musculus (mouse): 107448Help
Entry
107448            CDS       T01002                                 

Gene name
Unc5a, Unc5h1, mKIAA1976
Definition
(RefSeq) unc-5 netrin receptor A
  KO
K07521  netrin receptor unc-5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    107448 (Unc5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPA ZU5 Death TSP_1 Ig_3 I-set Ig_2 ig Adeno_E3_CR2
Motif
Other DBs
NCBI-GeneID: 107448
NCBI-ProteinID: NP_694771
MGI: 894682
Ensembl: ENSMUSG00000025876
Vega: OTTMUSG00000032671
UniProt: Q8K1S4
Position
13; 13 B1
AA seq 898 aa AA seqDB search
MAVRPGLWPALLGIVLTAWLRGSGAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKP
VLLVCKAVPATQIFFKCNGEWVRQVDHVIERSTDGSSGLPTMEVRINVSRQQVEKVFGLE
EYWCQCVAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAE
VEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVY
VNGGWSTWTEWSVCSASCGRGWQKRSRSCTNPAPLNGGAFCEGQNVQKTACATLCPVDGS
WSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECRGADLDTRNCTSDLCLHTSSGPEDVA
LYIGLVAVAVCLILLLLVLVLIYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLL
TIQPDLSTTTTTYQGSLCPRQDGPSPKFQLSNGHLLSPLGSGRHTLHHSSPTSEAEDFVS
RLSTQNYFRSLPRGTSNMAYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLHK
PEDVRLPLAGCQTLLSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSCEGSW
EDVLHLGEESPSHLYYCQLEAGACYVFTEQLGRFALVGEALSVAATKRLRLLLFAPVACT
SLEYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDVPSSLW
KSKLLVSYQEIPFYHIWNGTQQYLHCTFTLERVNASTSDLACKVWVWQVEGDGQSFNINF
NITKDTRFAEMLALESEGGVPALVGPSAFKIPFLIRQKIITSLDPPCSRGADWRTLAQKL
HLDSHLSFFASKPSPTAMILNLWEARHFPNGNLGQLAAAVAGLGQPDAGLFTVSEAEC
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggccgtccggcccggcctgtggccagcgctcctgggcatagtcctcactgcctggctt
cgtggttcgggtgcccagcagagtgccacagtggccaacccagtgcctggtgccaacccg
gacctgctgccccacttcctggtagagccggaggacgtgtacattgtcaagaacaagccc
gtgctgctggtgtgcaaggctgtgcccgccacccagatcttcttcaagtgcaacggggaa
tgggttcgccaggtcgatcacgtcattgaacgcagcactgacggcagcagcggattgcca
accatggaggtccggatcaacgtatcaaggcagcaggtcgagaaagtgtttgggctggag
gagtactggtgccagtgtgtggcatggagctcctcaggaaccaccaaaagccagaaggcc
tacatccggattgcctatttgcgcaagaactttgagcaggagccgctggccaaggaagtg
tcactggagcaaggcattgtgctaccttgtcgccccccggaaggaatccccccagctgag
gtggagtggctccgaaatgaggacctcgtggacccctccctcgaccccaatgtgtacatc
acacgggagcacagcctagtcgtgcggcaggcccgcctggccgacactgccaactacacc
tgcgtggccaagaacatcgtggcccgtcgccgaagcgcctctgcggccgtcattgtttat
gtgaacggtgggtggtcgacgtggaccgagtggtccgtctgcagtgccagctgtgggcgt
ggctggcagaaacggagccggagctgcaccaacccggcacctctcaacgggggcgccttc
tgtgaggggcagaatgtccagaaaacagcctgcgccactctgtgcccagtggatgggagc
tggagcccatggagtaagtggtcagcctgcgggcttgactgcacccactggcggagccgg
gagtgctccgacccagcgccccgcaacggaggtgaggagtgccggggtgctgacctggac
acccgcaactgtaccagtgacctctgcctgcacacctcttccggccccgaggacgtggct
ctctacatcggcctcgtcgccgtggccgtgtgcctcatcttgctgctgctggtcctcgtc
ctcatctactgccgcaagaaggaaggactggactcagacgtggctgactcatccatcctt
acctcaggcttccagcctgtcagcatcaagcccagcaaagcagacaatccccatctgctc
accatccaaccggacctcagcaccaccacgaccacctaccagggcagcctgtgtccccgg
caggatggacccagccccaagttccagctctctaatggtcacctgctcagcccactgggc
agtggccgccatacgctgcaccacagctcccccacctctgaggctgaggacttcgtctcc
cgcctctccacccaaaactactttcgttctctgccccgcggtaccagcaacatggcctat
gggaccttcaacttcctcgggggccggctgatgatccctaacacaggaatcagcctcctc
atacccccggacgccatcccccgaggaaagatctacgagatctacctcactctgcacaag
ccagaagacgtgaggttgcccctagctggctgtcagaccctgctgagtcctatcgttagc
tgtgggcccccaggagtcctgctcacccggccagtcatccttgccatggaccactgcggg
gagcccagtcccgacagctggagcctgcgcctcaaaaagcagtcctgtgagggcagctgg
gaggacgtgctgcaccttggtgaggagtcgccctctcatctctactactgccagctggag
gccggggcctgctatgtcttcaccgagcagctaggccgctttgccctggtgggagaggcc
ctcagcgtggctgccaccaagcgcctcaggctccttctgtttgcccctgtggcctgtacg
tccctcgagtacaacatccgagtgtactgcctgcacgacacccacgatgctctcaaggag
gtggtgcagctggagaagcagctgggtggacagctgatccaggagccccgtgtcctgcac
ttcaaagacagttaccacaacctacgtctgtccatccacgacgtgcccagctccctgtgg
aagagcaagctccttgtcagctaccaggagatccctttttaccacatctggaatggcact
cagcagtatctgcactgcaccttcaccctggagcgcgtcaatgccagcaccagcgacctg
gcctgcaaggtgtgggtgtggcaggtggagggagatggacagagcttcaacatcaacttt
aacatcactaaggacacgaggtttgctgaaatgctggctctggagagtgaagggggggtc
ccagccctggtgggccccagtgccttcaagatccccttcctcattcggcaaaagatcatt
accagcctggacccaccctgcagccggggcgccgactggcgaactctagcccagaaactt
cacctggacagccatcttagcttctttgcctccaagcccagccctacagccatgatcctc
aacctatgggaggcgcggcacttccccaacggcaacctcggccagctggccgcagctgtg
gccggactgggccagccagatgctggcctcttcaccgtgtcagaggccgagtgctga

DBGET integrated database retrieval system