KEGG   Mus musculus (mouse): 107449Help
Entry
107449            CDS       T01002                                 

Gene name
Unc5b, 6330415E02Rik, A630020F16, D10Bwg0792e, Unc5h2
Definition
(RefSeq) unc-5 netrin receptor B
  KO
K07521  netrin receptor unc-5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    107449 (Unc5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPA ZU5 Death I-set Ig_3 TSP_1 Ig_2 ig SKG6
Motif
Other DBs
NCBI-GeneID: 107449
NCBI-ProteinID: NP_084046
MGI: 894703
Ensembl: ENSMUSG00000020099
UniProt: Q8K1S3
Structure
PDB: 

Position
10 B4; 10 31.52 cM
AA seq 945 aa AA seqDB search
MRARSGVRSALLLALLLCWDPTPSLAGVDSAGQVLPDSYPSAPAEQLPYFLLEPQDAYIV
KNKPVELHCRAFPATQIYFKCNGEWVSQNDHVTQESLDEATGLRVREVQIEVSRQQVEEL
FGLEDYWCQCVAWSSSGTTKSRRAYIRIAYLRKNFDQEPLAKEVPLDHEVLLQCRPPEGV
PVAEVEWLKNEDVIDPAQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTAT
VIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTVCP
VDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCVLNQRTL
NDPKSHPLETSGDVALYAGLVVAVFVVVAVLMAVGVIVYRRNCRDFDTDITDSSAALTGG
FHPVNFKTARPNNPQLLHPSAPPDLTASAGIYRGPVYALQDSADKIPMTNSPLLDPLPSL
KIKVYNSSTIGSGSGLADGADLLGVLPPGTYPGDFSRDTHFLHLRSASLGSQHLLGLPRD
PSSSVSGTFGCLGGRLSLPGTGVSLLVPNGAIPQGKFYDLYLHINKAESTLPLSEGSQTV
LSPSVTCGPTGLLLCRPVVLTVPHCAEVIAGDWIFQLKTQAHQGHWEEVVTLDEETLNTP
CYCQLEAKSCHILLDQLGTYVFMGESYSRSAVKRLQLAIFAPALCTSLEYSLRVYCLEDT
PVALKEVLELERTLGGYLVEEPKPLLFKDSYHNLRLSLHDIPHAHWRSKLLAKYQEIPFY
HVWNGSQRALHCTFTLERHSLASTEFTCKVCVRQVEGEGQIFQLHTTLAETPAGSLDALC
SAPGNAITTQLGPYAFKIPLSIRQKICSSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKA
SPTGVILDLWEARQQDDGDLNSLASALEEMGKSEMLVAMATDGDC
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgagggcccggagcggggtgcggagcgcgctgctgctggcgctgctgctttgctgggat
ccgacaccgagcctagcaggcgttgactctgctggccaggtgctcccagactcctaccca
tcagcccctgcggagcagctgccgtacttcctattggagccacaggacgcctacatcgta
aagaacaagccagtggaactgcactgcagagccttccctgccacgcagatctacttcaag
tgtaatggcgagtgggtcagccagaatgaccacgtcacacaggagagcctggatgaggcc
acaggcttgcgggtgcgagaggtgcagatcgaggtgtcacggcagcaagtggaggaactc
ttcgggctcgaggactactggtgccagtgcgtggcctggagctcttcgggaactaccaag
agtcgccgagcctacatccgcattgcctacttgcgcaagaactttgaccaggagcctctg
gccaaggaggtacccttggatcatgaggtccttctgcagtgccgcccaccggagggagtg
cctgtggctgaggtggaatggctcaagaatgaagatgtcattgaccccgctcaggacact
aacttcctgctcaccattgaccacaacctcatcatccgccaggcgcgcctctcagacacg
gccaactacacctgtgtggccaagaatatcgtggccaagcgccggagcaccacggccaca
gtcatcgtctatgtgaatggaggctggtccagctgggcagagtggtcaccctgttccaat
cgctgtggccgaggctggcagaagcgtactcggacctgcaccaatccagccccactcaat
ggaggcgccttctgtgagggacaggccttccagaagacagcttgcaccaccgtgtgccca
gtggatggagcgtggaccgagtggagcaagtggtctgcctgcagcacagagtgtgcgcac
tggcgcagccgcgagtgcatggcaccgccaccccagaacggaggccgtgactgcagcggg
acgctacttgactccaagaactgcactgatgggctgtgcgtgctgaatcagagaactcta
aacgaccctaaaagccaccccctggagacatcgggagatgtggcactgtacgcaggcctt
gtggtggccgtctttgtggtggtagcggttctcatggccgtgggagtgatcgtataccgg
agaaactgccgggacttcgacacggacatcaccgactcctctgcggccctcactggtggc
ttccaccctgtcaacttcaagactgcaaggcccaacaacccgcagctcctgcacccgtcc
gcccctccagacctaacggccagtgctggcatctaccgcgggcctgtgtatgccctgcag
gactccgccgacaagatccccatgactaattcgcccctgctggatcccctgcccagcctc
aagatcaaggtctataactccagcaccatcggttctgggtctggcctggctgatggagcc
gacctgctgggtgtcctcccgccgggcacgtacccaggcgatttctcccgggacacccat
ttcctgcacctgcgcagtgccagccttggttcccagcacctcctgggcctacctcgggac
cccagcagcagtgtcagcggcacctttggttgcctgggaggaaggctgagcctccccggc
acaggggtcagcctgttggtaccaaatggagccattccccagggcaagttctatgacctg
tatctacatatcaacaaggccgaaagcaccctcccactttcagaaggttcccagacagta
ttgagcccctcggtgacctgtgggcccacaggcctactcctgtgccgccctgtcgtcctc
accgtgccccactgtgctgaagtcatcgctggagactggatctttcagctcaagacccag
gcccatcagggccactgggaggaggtggtgaccttggatgaggagaccctcaacacaccc
tgctactgccagctggaggctaagtcctgccacatcctgctggaccagctgggtacctac
gtattcatgggcgagtcctactctcgctctgcagtcaagcggctccagctggccatcttc
gccccagccctctgcacctccctggagtatagcctcagggtctactgtctggaggacaca
cctgtagcactgaaggaggtcctggagctggagaggactctgggtggctacttggtggag
gagcccaagcctttgctctttaaggacagttaccacaacctacgcctctccctccatgac
atcccccatgcccactggaggagcaaactactggccaagtaccaggagattcccttctac
cacgtctggaatggcagccagagagccctgcactgcactttcaccctggagaggcatagc
ctggcctccacggagttcacctgtaaggtctgcgtgcggcaggtcgaaggggaaggccag
attttccagctgcacacaacgttggccgagacgcctgctggctccctggatgctctctgc
tctgccccgggcaatgccatcaccacccagctgggaccctatgccttcaagatacccctg
tccatccgccaaaagatctgcagcagcctggacgcccccaactcccggggcaacgactgg
aggctgttggcgcagaagctgtccatggaccggtacctaaactacttcgccaccaaagct
agtcccacaggtgtcatcttagacctctgggaagctcggcaacaggatgacggggacctc
aacagcctggccagtgccttggaggagatgggcaagagtgagatgctggtagccatggcc
acagatggcgattgctga

DBGET integrated database retrieval system