KEGG   Mus musculus (mouse): 107508
Entry
107508            CDS       T01002                                 

Symbol
Eprs, 2410081F06Rik, 3010002K18Rik, C79379, Eprs1, Qprs
Name
(RefSeq) glutamyl-prolyl-tRNA synthetase
  KO
K14163  bifunctional glutamyl/prolyl-tRNA synthetase [EC:6.1.1.17 6.1.1.15]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00860  Porphyrin and chlorophyll metabolism
mmu00970  Aminoacyl-tRNA biosynthesis
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    107508 (Eprs)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107508 (Eprs)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    107508 (Eprs)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    107508 (Eprs)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     107508 (Eprs)
    6.1.1.17  glutamate---tRNA ligase
     107508 (Eprs)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   107508 (Eprs)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107508 (Eprs)
SSDB
Motif
Pfam: tRNA-synt_1c WHEP-TRS tRNA-synt_1c_C ProRS-C_1 HGTP_anticodon tRNA-synt_2b GST_C GST_C_3 tRNA-synt_1e GST_C_2
Other DBs
NCBI-GeneID: 107508
NCBI-ProteinID: NP_084011
MGI: 97838
Ensembl: ENSMUSG00000026615
Vega: OTTMUSG00000050732
UniProt: Q8CGC7
Position
1; 1 H5
AA seq 1512 aa
MAALCLTVNAGNPPLEALLAVEHVKGDVSISVEEGKENLLRVSETVAFTDVNSILRYLAR
IATTSGLYGTNLMEHTEIDHWLEFSATKLSSCDRLTSAINELNHCLSLRTYLVGNSLTLA
DLCVWATLKGSAAWQEHLKQNKTLVHVKRWFGFLEAQQAFRSVGTKWDVSGNRATVAPDK
KQDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTN
PEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIQEGKAYVDDTPAEQMK
AEREQRTESKHRKNSVEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGCMRDPTLYRCK
IQPHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYI
WEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGS
SRSVVNMEWDKIWAFNKKVIDPVAPRYVALLKKEVVPVNVLDAQEEMKEVARHPKNPDVG
LKPVWYSPKVFIEGADAETFSEGEMVTFINWGNINITKIHKNADGKITSLDAKLNLENKD
YKKTTKITWLAESTHALSIPAVCVTYEHLITKPVLGKDEDFKQYINKDSKHEELMLGDPC
LKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCREAPCILIYIPDGHTKEMPTSGSKEKTK
VEISKKETSSAPKERPAPAVSSTCATAEDSSVLYSRVAVQGDVVRELKAKKAPKEDIDAA
VKQLLTLKAEYKEKTGQEYKPGNPSAAAVQTVSTKSSSNTVESTSLYNKVAAQGEVVRKL
KAEKAPKAKVTEAVECLLSLKAEYKEKTGKDYVPGQPPASQNSHSNPVSNAQPAGAEKPE
AKVLFDRVACQGEVVRKLKAEKASKDQVDSAVQELLQLKAQYKSLTGIEYKPVSATGAED
KDKKKKEKENKSEKQNKPQKQNDGQGKDSSKSQGSGLSSGGAGEGQGPKKQTRLGLEAKK
EENLAEWYSQVITKSEMIEYYDVSGCYILRPWSYSIWESIKDFFDAEIKKLGVENCYFPI
FVSQAALEKEKNHIEDFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDL
PVRLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATFEEAADEVLQILELYARVYEEL
LAIPVVRGRKTEKEKFAGGDYTTTIEAFISASGRAIQGATSHHLGQNFSKMCEIVFEDPK
TPGEKQFAYQCSWGLTTRTIGVMVMVHGDNMGLVLPPRVASVQVVVIPCGITNALSEEDR
EALMAKCNEYRRRLLGANIRVRVDLRDNYSPGWKFNHWELKGVPVRLEVGPRDMKSCQFV
AVRRDTGEKLTIAEKEAEAKLEKVLEDIQLNLFTRASEDLKTHMVVSNTLEDFQKVLDAG
KVAQIPFCGEIDCEDWIKKMTARDQDVEPGAPSMGAKSLCIPFNPLCELQPGAMCVCGKN
PAKFYTLFGRSY
NT seq 4539 nt   +upstreamnt  +downstreamnt
atggcggcgctgtgcctcacggtgaacgccggaaaccctccgctggaagctctgctggcg
gtggaacatgtgaaaggtgatgtcagcatttctgtggaagaagggaaagagaatcttctt
cgggtttctgagactgtggcattcactgacgtgaattcaatcctgcgctacctggctaga
attgcaactacgtctgggctgtatgggactaacctgatggagcacactgagattgatcat
tggttggagtttagtgctacaaagttgtcttcgtgtgataggctgacttctgcaatcaac
gagcttaatcattgcctgtctctgagaacatacctagttgggaactccttgaccttagca
gatctatgtgtttgggccaccctaaaaggaagtgctgcatggcaggaacacttgaaacag
aacaaaactctagtccacgttaaacgctggtttggctttcttgaggcccagcaggccttc
cgctcagttggcaccaagtgggatgtttcaggaaacagagctacagtggcacctgacaaa
aaacaagatgttgggaaattcgtggagcttccaggtgcagagatgggaaaggtgacagtc
agattccccccagaggctagtggttacttacacattgggcatgcgaaagctgctcttctg
aaccagcactaccaggttaactttaaagggaaactgatcatgagatttgatgacacaaac
ccagaaaaggaaaaggaagattttgagaaggtcatcttggaagatgttgcaatgctgcat
attaaaccagatcagtttacttacacttcagatcattttgaaactataatgaagtatgca
gagaaattaattcaagaagggaaggcttatgtggatgacactcctgcagaacagatgaag
gcggaacgtgaacagaggacagaatccaaacacaggaagaactctgttgagaagaatcta
cagatgtgggaagaaatgaaaaaaggaagccagtttggtcagtcctgttgcctgcgagca
aaaattgacatgagtagtaacaatgggtgtatgagagacccgaccctttaccgatgcaaa
atccagccccacccaaggactgggaataaatacaatgtttatccaacatatgactttgcc
tgccctatagtggacagcattgaaggtgttactcatgccttgaggacaacagagtaccac
gaccgagatgaacaattttattggatcattgaagctttaggcataaggaaaccatacatc
tgggagtacagtcgcttaaatctcaacaacaccgtgctgtccaaaagaaagctcacgtgg
tttgtcaatgaaggactggtagatggatgggatgacccacggtttcctacagttcgtgga
gttctgagaagagggatgacagttgaggggctgaagcagttcattgctgctcagggctcc
tcaaggtctgttgtgaacatggaatgggacaaaatctgggcgttcaacaaaaaggttatt
gacccagtggctccacggtacgttgcattgctgaagaaggaagtcgtcccagtgaatgtc
ctggatgcgcaggaggagatgaaggaagtagccagacaccccaagaatcctgatgttggt
ttgaagcctgtgtggtacagtcccaaggttttcatagaaggggccgatgcagagactttc
tcagagggtgagatggtcacatttataaactggggcaacatcaacattactaaaatacac
aaaaatgcagatggaaaaattacatctctagatgcaaaattgaatttggaaaacaaagac
tacaagaaaaccaccaagatcacttggcttgctgagagcacacacgctctctcgatccca
gccgtctgtgtcacttatgagcacttgatcacaaagccagtgctgggaaaagatgaggac
ttcaagcagtacatcaacaaagacagtaagcatgaagagctaatgctaggagatccttgc
cttaaagatctgaaaaaaggagacatcatacaactgcagaggagagggttcttcatatgc
gaccagccatacgaacctgtcagcccatatagttgcagagaagctccatgcatcctgata
tacatacctgatgggcacacaaaggaaatgccaacatccggatcaaaggaaaagaccaaa
gtggaaatctcaaaaaaggagacaagctctgctcctaaagaaagaccagcacctgctgtg
agttctacttgtgctacagctgaggattcctccgtcctctacagcagagtggcggtgcag
ggggatgtggttcgtgaattgaaagccaagaaagcgccaaaggaagatatagacgcagct
gtgaagcagcttttgactttgaaagctgaatataaagagaaaactgggcaggagtataaa
cctgggaacccctctgctgcagcagtacagactgtttctacaaagtcatcatcaaacact
gtggaaagtacatctttatacaataaagtcgctgcccaaggggaggtggtccgaaagctg
aaagcggaaaaggctcctaaggctaaagtaactgaagctgtggaatgtttgctgtccctg
aaagctgagtataaagaaaagactgggaaggactatgtacctggccagcccccagcatcg
cagaactcacattcaaaccctgtcagtaatgctcagcctgctggagcggagaaaccagaa
gccaaagtgctatttgacagagtggcttgtcaaggagaagtagttcgaaaacttaaagct
gaaaaggcctctaaggatcaagtggattcggcggtacaagaacttcttcagctgaaggca
cagtacaagtcgctgacaggaatcgagtataagcctgtgtctgctactggggcagaagac
aaagataaaaagaagaaagaaaaagaaaataaatctgaaaagcagaacaagcctcagaaa
caaaatgatggccaagggaaagactcttccaaaagccaaggcagtggcctgtcatcaggt
ggagcaggagaagggcaggggcctaagaaacagaccagattgggtcttgaagcaaaaaaa
gaagaaaatcttgccgaatggtactctcaagtcatcacaaagtccgagatgattgaatac
tacgatgtgagtggctgctatatcctccgtccctggtcgtactccatctgggagtccatt
aaggacttctttgacgctgagatcaagaagctcggtgttgagaactgctacttccccata
tttgtgtctcaggctgcgttagagaaagagaagaatcacatcgaagactttgctcctgag
gttgcttgggttacaagatcaggaaaaacagagttggcagagccaattgccattcgtcct
actagtgaaacagtgatgtatccggcatatgctaaatgggtgcagtcccacagagacctg
cccgtcaggctcaaccagtggtgcaatgtggtgcgctgggagttcaaacacccacagcct
ttcctccgaactcgggagttcctgtggcaggaggggcacagcgcctttgccacctttgag
gaagcagctgatgaggttttacagatccttgagttatatgctcgagtatatgaagagctc
ttagccattcctgttgtgagaggaaggaagactgaaaaggagaagtttgcaggaggagac
tacacaaccacaatagaagccttcatatctgccagcggacgcgccattcagggagcaaca
tcacaccatttaggccagaatttctccaaaatgtgtgaaatagtttttgaagatcccaag
acaccaggagaaaagcagtttgcataccagtgctcctggggcctgacaacacgaaccatc
ggtgtgatggtcatggtccatggggacaacatgggcctagtgcttccaccccgagtagca
tctgtccaggtggtagtcattccctgtggaatcacaaatgccctgtctgaagaagacaga
gaggcactgatggcaaaatgcaacgagtacagaaggcggctgcttggtgctaacatccga
gtccgagtcgatctacgagacaactactccccaggctggaagttcaaccactgggaactc
aagggagttccagtcagacttgaggtggggccacgtgatatgaagagctgtcagtttgta
gcagtcagacgagatactggagagaaactgacaattgctgagaaggaggctgaggctaag
ctggaaaaggttttggaagacatccagctgaaccttttcacaagggcttctgaagacctt
aaaacccacatggttgtgtctaatacactggaggacttccagaaggtgctagatgctgga
aaggttgcacagattccattttgtggggaaattgactgtgaggactggatcaaaaagatg
actgccagggatcaagatgtggaacctggtgctccatccatgggagccaaaagcctttgc
attcctttcaaccctctgtgtgagctgcagcccggagccatgtgtgtctgtggcaagaat
cctgccaagttctacaccttgtttggtcggagttactga

DBGET integrated database retrieval system