KEGG   Mus musculus (mouse): 107513
Entry
107513            CDS       T01002                                 

Gene name
Ssr1, 2510001K09Rik, 6330400D04, AI159733, AI452176, SSR, TR, TRAPA
Definition
(RefSeq) signal sequence receptor, alpha
  KO
K13249  translocon-associated protein subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107513 (Ssr1)
SSDB
Motif
Pfam: TRAP_alpha
Other DBs
NCBI-GeneID: 107513
NCBI-ProteinID: NP_080241
MGI: 105082
Ensembl: ENSMUSG00000021427
UniProt: Q9CY50
Position
13; 13 A3.3
AA seq 286 aa
MRLLPRLLLLFLLAFPAAVLLRGGPGGSLALAQDPTEDEEIVEDSIIEDEDDEAEVEEDE
PTDLAEDKEEEDVSSEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESL
DASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDL
NGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVVVGLHQLLESRKRKRPIQK
VEMGTSSQNDVDMSWIPQETLNQINKASPRRQPRKRAQKRSVGSDE
NT seq 861 nt   +upstreamnt  +downstreamnt
atgagactcctcccccgcctgctgctgctgttcctgctggcctttcccgccgccgtgctg
ctccgaggcggccccggagggtcattagctttggctcaagatcctacagaagatgaagaa
atagtggaagattcaataattgaagatgaagatgatgaagctgaagtagaagaagatgaa
cccacagatttggcagaagataaagaagaggaggatgtatccagtgaaccagaagcttca
cccagtgcagacacaactattctgtttgtaaaaggagaagattttccggcaaacaacatc
gtgaagttcctggttggctttacaaacaaggggacagaagattttattgttgaatcgcta
gatgcctcgttccgttatcctcaggactaccagttttacatccagaatttcacagctctt
cctctaaacactgtagtgccaccccagcggcaggcaacttttgagtattccttcatccct
gcagagccgatgggaggacgaccctttggtctggttatcaatctgaactacaaagatttg
aacggcaatgtattccaggatgctgtcttcaatcagacggtcacagttattgaaagagag
gacgggttagatggagaaacaatttttatgtatatgttccttgctggtcttgggcttctg
gttgttgttggccttcatcagctcctggaatctagaaagcgcaagagacccatacagaaa
gtagaaatgggtacctcaagtcagaatgatgttgacatgagctggattcctcaggagact
ttgaatcagatcaataaagcttctcccagaaggcagccccggaagcgggcgcagaagcga
tcggtgggatctgatgagtaa

KEGG   Mus musculus (mouse): 20832
Entry
20832             CDS       T01002                                 

Gene name
Ssr4, AW743063, C78062, SSR-delta, T, TRAP-delta, Trap
Definition
(RefSeq) signal sequence receptor, delta
  KO
K04571  translocon-associated protein subunit delta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    20832 (Ssr4)
SSDB
Motif
Pfam: TRAP-delta MVL
Other DBs
NCBI-GeneID: 20832
NCBI-ProteinID: NP_033305
MGI: 1099464
Ensembl: ENSMUSG00000002014
Vega: OTTMUSG00000018078
UniProt: Q62186 Q3TVJ8
Position
X A7.3; X 37.41 cM
AA seq 172 aa
MAAMASFGALALLLLSGLSCCSEACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRV
QNMALYADVSGKQFPVTRGQDVGRYQVSWSLEHKSAHAGTYEVRFFDEESYSLLRKAQRN
NEDVSIIPPLFTVSVDHRGTWNGPWVSTEVLAAVIGIVIYYLAFSAKSHIQA
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcggcgatggcatctttcggcgccctggcactactcctgctgtctggcctatcttgc
tgctcagaggcctgcctggaaccacagatcaccccttcttactatacaacttcagatgcc
gtcatttctacagagactgtattcatcgtggagatttcactgacctgcaagaacagggtc
cagaacatggctctttatgccgacgttagtggaaaacaatttcctgtaacccgcggccag
gatgtgggtcgatatcaggtgtcctggagcctggagcacaagagcgctcatgcgggcacc
tatgaggtcagattctttgatgaagagtcctatagcctcctaaggaaggctcagagaaat
aatgaggacgtttctatcattccacccctgttcacagtcagtgtggaccatcggggtacc
tggaatgggccttgggtctccacagaggtgctggctgcagtaattggcatagtgatctac
tacctagctttcagtgcaaagagccacatccaggcctga

KEGG   Mus musculus (mouse): 66256
Entry
66256             CDS       T01002                                 

Gene name
Ssr2, 1500032E05Rik, AI315033, AU020133, SSR-beta, TLAP, TRAP, TRAPB, TRAPbeta
Definition
(RefSeq) signal sequence receptor, beta
  KO
K13250  translocon-associated protein subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    66256 (Ssr2)
SSDB
Motif
Pfam: TRAP_beta BatD Yop-YscD_cpl
Other DBs
NCBI-GeneID: 66256
NCBI-ProteinID: NP_079724
MGI: 1913506
Ensembl: ENSMUSG00000041355
Vega: OTTMUSG00000052161
UniProt: Q9CPW5
Position
3; 3 F1
AA seq 183 aa
MRLLAVVVLALLAVSQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELS
DDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPV
VIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKP
KKN
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaggctgctggcggttgtggtgttggctctgttagccgtcagtcaagcagaagaagga
gccaggcttttggcctccaaatcattgctcaacagatacgctgtggaagggagggacctg
accctgcagtataacatctacaacgtcggctccagcgctgcattagatgtggaattatct
gacgattccttccctccagaagacttcggcattgtctccggtatgctcaatgtcaaatgg
gaccggattgcccccgctagcaatgtctcccacacagttgtcctgcgtcctctcaaagct
ggctacttcaacttcacttctgccacgattacttacctggcccaggaggatggacctgtt
gtgattggctccaccagcgcccctggacagggaggaatcctcgctcagcgggagtttgac
aggagattctccccccattttctggactgggcagcctttggggtcatgaccttgccctcc
ataggcatccccctgctcctgtggtattccagcaagaggaagtacgatactcccaaaccc
aagaagaactga

KEGG   Mus musculus (mouse): 67437
Entry
67437             CDS       T01002                                 

Gene name
Ssr3, 0610038P07Rik, AL022999, AU022074, AW553833, TRAPG, Trap-
Definition
(RefSeq) signal sequence receptor, gamma
  KO
K13251  translocon-associated protein subunit gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    67437 (Ssr3)
SSDB
Motif
Pfam: TRAP-gamma Renin_r
Other DBs
NCBI-GeneID: 67437
NCBI-ProteinID: NP_080431
MGI: 1914687
Ensembl: ENSMUSG00000027828
Vega: OTTMUSG00000028773
UniProt: Q9DCF9 Q4FK79
Position
3; 3 E1
AA seq 185 aa
MAPKGGSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAV
LYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDER
ILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPTVNYILSISASSGLIALL
STGSK
NT seq 558 nt   +upstreamnt  +downstreamnt
atggctcccaaaggcggctccaagcagcagtccgaggaggacctgctccttcaggatttc
agccgcaacctgtcggccaaatcgtcggcgctgttcttcgggaacgcgttcatcgtgtct
gccatccccatctggttgtattggagaatatggcatatggatctcatccagtctgctgtg
ctctacagtgtgatgaccttagtaagcacttacttagtagccttcgcgtacaagaatgta
aaatttgttctgaagcacaaagtggcacagaagagggaggatgctgtttccaaagaagtg
actcgaaagctttctgaagctgataataggaagatgtcccggaaggagaaagacgaaaga
atcctgtggaagaagaatgaagttgctgattatgaagctacaacattctccatcttctat
aacaacactctgttcctggttctggttattgttgcttccttctttatactgaagaacttc
aaccccacagtaaactacattttgtccataagtgcttcatctggactcatcgccctcttg
tctactggctccaaatag

DBGET integrated database retrieval system