KEGG   Mus musculus (mouse): 107566Help
Entry
107566            CDS       T01002                                 

Gene name
Arl2bp, 1700010P10Rik, 1700027H16Rik, 6330544B05Rik, AI482273, AI849834, BART, Bart1
Definition
(RefSeq) ADP-ribosylation factor-like 2 binding protein
  KO
K16742  ADP-ribosylation factor-like protein 2-binding protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    107566 (Arl2bp)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    107566 (Arl2bp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARL2_Bind_BART
Motif
Other DBs
NCBI-GeneID: 107566
NCBI-ProteinID: NP_077153
MGI: 1349429
Ensembl: ENSMUSG00000031776
Vega: OTTMUSG00000061690
UniProt: Q9D385
Position
8; 8 C5
AA seq 163 aa AA seqDB search
MDALEEESFALSFSSASDAEFDAVVGCLEDIIMDDEFQLLQRNFMDKYYQEFEDTEENKL
TYTPIFNEYISLVEKYIEEQLLERIPGFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLA
FKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSTPASQNNLRH
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggacgccctagaagaagagagcttcgcgctgtccttctcctccgcctctgatgcagaa
tttgatgctgtggttggatgtttagaggacattattatggatgatgagttccagttattg
cagagaaacttcatggacaagtactaccaggaatttgaagacacagaagagaataaactc
acctatacacccatttttaatgaatatatctccctggtagagaagtacattgaagagcag
ttgctggagcgtatcccaggcttcaacatggcggccttcacaaccacgctgcagcaccac
aaagatgaggtggctggcgacatctttgacatgctgctcacattcacggattttctggct
ttcaaggagatgttcctggactacagagcagaaaaggaaggccgaggactggacttaagc
agcggcttggttgtgacttctctgtgtaagtcatcttctacgccagcttcccagaacaac
ctgcggcactag

DBGET integrated database retrieval system