KEGG   Mus musculus (mouse): 107581
Entry
107581            CDS       T01002                                 

Gene name
Col16a1, 2700007F12Rik, A530052M23Rik, AI838662, CA1F
Definition
(RefSeq) collagen, type XVI, alpha 1
  KO
K24339  collagen type XVI alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    107581 (Col16a1)
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 107581
NCBI-ProteinID: NP_082542
MGI: 1095396
Ensembl: ENSMUSG00000040690
Vega: OTTMUSG00000009516
UniProt: Q8BLX7
Position
4; 4 D2.2
AA seq 1580 aa
MLTSWAPGLWVLGLWATFSHGTNIGERCPTSQQEGLKLEHSSDPSTNVTGFNLIRRLNLM
KTSAIKKIRNPKGPLILRLGAAPVTQPTRRVFPRGLPEEFALVLTVLLKKHTFRNTWYLF
QVTDANGYPQISLEVNSQERSLELRAQGQDGDFVSCIFPVPQLFDLRWHKLMLSVAGRVA
SVHVDCVSASSQPLGPRQSIRPGGHVFLGLDAEQGKPVSFDLQQAHIYCDPELVLEEGCC
EILPGGCPPETSKSRRDTQSNELIEINPQTEGKVYTRCFCLEEPQNSKVDAQLMGRNIQK
AERGTKVHQGTGVNECPPCAHSARESNVTLGPSGLKGGKGERGLTGPSGPKGEKGARGND
CVRVSPDAPLQCVEGPKGEKGESGDLGPPGLPGPTGQKGQKGEKGDGGLKGLPGKPGRDG
RPGEICVIGPKGQKGDPGFVGPEGLAGEPGPPGLPGPPGIGLPGTPGDPGGPPGPKGEKG
SSGIPGKEGPGGKPGKPGVPGTKGEKGDPCEVCPTLPEGSQNFVGLPGKPGPKGEPGDPA
PAWEGLGTVGLKGDRGDPGIQGMKGEKGEPCSSCSSGVGAQHLGPSPGHGLPGLPGTSGI
PGPRGLKGEKGSFGDTGPAGVPGSPGPVGPAGIKGAKGEPCEPCTALSELQDGDMRVVHL
PGPAGEKGEPGSPGFGLPGKQGKAGERGLKGQKGDAGNPGDPGTPGITGQPGISGEPGIR
GPAGPKGEKGDGCTACPSLQGALTDVSGLPGKPGPKGEPGPEGVGHPGKPGQPGLPGVQG
PPGPKGTQGEPGPPGTGAEGPQGEPGTQGLPGTQGLPGPRGPPGSAGEKGAQGSPGPKGA
IGPMGPPGAGVSGPPGQKGSRGEKGEPGECSCPSRGEPIFSGMPGAPGLWMGSSSQPGPQ
GPPGVPGPPGPPGMPGLQGVPGHNGLPGQPGLTAELGSLPIEKHLLKSICGDCAQGQTAH
PAFLLEKGEKGDQGIPGVPGFDNCARCFIERERPRAEEARGDNSEGEPGCSGSPGLPGPP
GMPGQRGEEGPPGMRGSPGPPGPIGLQGERGLTGLTGDKGEPGPPGQPGYPGAMGPPGLP
GIKGERGYTGPSGEKGESGPPGSEGLPGPQGPAGPRGERGPQGSSGEKGDQGFQGQPGFP
GPPGPPGFPGKAGAPGPPGPQAEKGSEGIRGPSGLPGSPGPPGPPGIQGPAGLDGLDGKD
GKPGLRGDPGPAGPPGLMGPPGFKGKTGHPGLPGPKGDCGKPGPPGSSGRPGAEGEPGAM
GPQGRPGPPGHLGPPGQPGPPGLSTVGLKGDRGVPGERGLAGLPGQPGTPGHPGPPGEPG
SDGAAGKEGPPGKQGLYGPPGPKGDPGPAGQKGQAGEKGRSGMPGGPGKSGSMGPIGPPG
PAGERGHPGSPGPAGNPGLPGLPGSMGDMVNYDDIKRFIRQEIIKLFDERMAYYTSRMQF
PMEVAAAPGRPGPPGKDGAPGRPGAPGSPGLPGQIGREGRQGLPGMRGLPGTKGEKGDIG
VGIAGENGLPGPPGPQGPPGYGKMGATGPMGQQGIPGIPGPPGPMGQPGKAGHCNPSDCF
GAMPMEQQYPPMKSMKGPFG
NT seq 4743 nt   +upstreamnt  +downstreamnt
atgttgacatcctgggctcccggcctgtgggtgctcgggctctgggccaccttcagccat
gggacaaatataggtgagcggtgcccaacttcacagcaagaaggactcaagctagaacac
agtagtgacccatcaaccaacgtgactggcttcaacctaatccgccgactgaacctcatg
aagacatctgccatcaagaagatccgcaaccccaaggggccactcatcttgaggctgggg
gctgccccagtgacccaaccaactcgacgagtgttccctcgaggcctcccagaggagttt
gccctggtcctgacagtgcttctgaagaaacacaccttccggaacacatggtacttgttc
caagtgactgatgcaaatgggtacccacagatctccttggaagtcaacagccaggagcgg
agtctagagctccgggcacagggccaagatggtgactttgtgtcctgcatcttcccagtg
ccccagctcttcgatctgcgttggcacaagctgatgctgagcgtggcaggccgtgtggcc
tctgtgcatgtggactgtgtctcagcttcctcccagcctctgggaccccggcaatccatc
cggcctgggggacatgtatttctgggcttggacgctgagcagggcaagccggtttcattt
gaccttcagcaggcgcacatctactgcgacccggagctggtgctggaggaaggctgctgt
gagatcttaccgggagggtgtcccccagagacctccaagtcacgccgggacacccagagc
aatgagctcattgagatcaatcctcagacagagggcaaggtctacacccggtgcttctgc
ttggaggaacctcagaacagcaaggtggacgcgcagctcatgggaagaaacatccagaaa
gcagaaagggggacaaaggtccaccaggggactggagttaatgagtgcccaccctgtgcc
cacagtgcccgggagagcaatgtcacacttggtccctctggcctcaagggagggaaaggc
gaacgaggcctgactggaccatcaggccccaagggagagaagggagcacggggcaatgac
tgtgttcgagtgtcccctgatgccccacttcagtgtgtagaaggcccgaaaggagagaag
ggagaatcaggggacttgggacccccaggactcccaggaccaacaggccagaagggccag
aaaggggagaagggtgatggaggcctcaaaggacttccaggaaagccaggacgagatggt
cggccaggagagatctgtgtcattggacccaaagggcagaaaggagacccaggctttgtt
gggcctgagggactggcaggagagcctgggccacctggcctccctggaccacctgggata
ggactgcctgggactcctggagatccaggtggcccaccaggccctaagggagaaaagggc
agctctggaataccaggaaaggaaggcccaggagggaagccggggaaaccaggagtgcca
gggactaagggagagaagggtgacccctgtgaagtgtgcccaacgctgcctgaagggtcc
cagaattttgtggggctccctggaaaaccagggcctaaaggggaaccaggtgatcctgct
ccagcctgggagggcctaggaactgtgggactgaaaggtgaccggggagatccaggcatc
caaggaatgaaaggagagaagggggagccctgctcatcctgtagttcaggggtcggagcc
cagcatcttgggccctctcctggccatggtttacctggccttccgggcacatctggaatt
cctgggccaagaggcctgaaaggggagaagggtagttttggcgatacaggaccggctgga
gttccgggatcaccaggaccagtgggaccagctggcatcaaaggggcaaagggggagccc
tgtgagccctgcacagccttgtctgagctacaagatggggacatgcgtgtggttcatctg
cccggcccagctggagagaagggagagcctgggtccccgggcttcgggctgcctgggaag
cagggtaaagcaggagagcgtggactcaaggggcagaagggggatgctgggaatccagga
gaccctggaacaccaggcatcacagggcagcctgggatatctggagagcctgggattcga
ggtcctgcaggaccaaaaggagaaaagggtgatggatgcactgcctgccctagcctgcag
ggggcgttgaccgatgtatcgggactgcctgggaaacctggccccaaaggagagccaggt
ccagaaggtgtgggccatcccggtaaaccaggccagcctggtctaccaggagttcaaggg
cccccaggaccgaagggcactcagggagagcctggacctccaggcacgggtgctgaggga
ccccagggggagcctggaacccagggtttgcctggcactcagggccttcccggacctcgg
ggaccacctggctcagctggggaaaagggtgcccagggatctccggggcccaaaggagcc
ataggacccatgggacctcctggtgctggtgtctcggggcctccgggccaaaagggatca
cgaggcgagaaaggtgaaccgggagagtgttcctgcccttctcggggagagcccatcttc
tcgggcatgccgggtgctccgggactatggatgggcagctcctcgcagccgggcccgcag
ggtcccccaggtgtccccggaccaccaggtccccccggaatgcctggattgcagggagtg
cctggacacaatggtttgccaggacagcccgggctcactgccgagctgggatccttaccc
atcgagaaacacctcctcaagagcatctgtggtgactgtgcccagggccagacggctcat
ccagccttccttctggagaaaggagaaaagggggaccagggcatccctggcgtgccaggt
tttgacaactgtgccaggtgcttcatagagagggaacgcccaagagctgaggaggccagg
ggagacaacagtgagggagaacctggctgttctgggagccctggcctgcctggtcctcca
gggatgccaggccaaagaggagaagagggtccacctggcatgaggggctctcccggtcct
ccaggccctattgggcttcaaggggagcgaggcctcacgggcctgactggagacaaagga
gaaccgggtcctccaggacaacctggctacccaggtgccatgggccccccaggactgcct
ggtatcaagggagagcgaggatacactggcccctcgggagagaagggcgaatcgggccca
ccaggatctgaaggccttccaggtccccaaggtccagcgggtccccgaggagagcgaggc
ccccaggggagctctggagagaagggtgaccagggatttcaaggccagccaggcttccca
ggcccaccgggtcctccaggattcccaggcaaagctggagctcctggcccacctggcccc
caagcagagaagggcagtgaagggattcgaggtccctcaggcttgcctgggtcccctggg
ccacccggccctcccgggattcagggccctgctgggctggacggactggacgggaaggac
ggcaagcctggcctgaggggggacccaggtcctgctggccctcccggactcatgggacct
ccaggcttcaaggggaaaacaggtcatcctggcctccctgggcctaagggtgactgtgga
aaacccggtcctcctggcagcagtggccggccaggggcagagggtgagcccggtgccatg
ggaccccagggacgaccaggacccccagggcatcttggtcctccaggccagccaggtcca
cctgggctctccactgtgggcctgaaaggagatcggggagtccctggagaaaggggcttg
gcgggcctcccaggccagcctggcacacccggacaccctggccctccaggtgagcctggt
tcggacggtgcagctggcaaagagggacctcctggaaagcagggactctatggaccccct
ggcccaaagggtgaccctggacctgcaggacagaagggccaagcaggagaaaagggaaga
tctggcatgccagggggtcctggcaagagcggctccatgggacctatcggaccaccgggg
cctgcaggagagagaggtcaccctgggtccccagggcctgcagggaaccctggattgcct
ggtttgccgggctctatgggagacatggtgaattatgatgatatcaagaggtttatcaga
caagagatcattaaactgtttgatgagaggatggcttactatacctccaggatgcagttc
cccatggaggtggcagcagctccaggccggccagggcctccggggaaggatggtgctcca
ggtcggccaggtgctccagggtcacccgggctccctggtcagataggccgagaaggacgc
cagggtttgccaggaatgagaggactgcctggtaccaaaggtgaaaagggagacattggt
gttggcattgcaggagaaaatggtctccctggccctccaggtcctcaagggcctccaggt
tatggcaagatgggtgcaactggaccaatgggccagcaaggtattcctgggatccctggg
cccccgggtcccatgggccagccagggaaggcaggccactgcaacccctcagactgcttt
ggggccatgccaatggagcagcagtacccacccatgaagagcatgaaggggcctttcggt
tga

DBGET integrated database retrieval system