KEGG   Mus musculus (mouse): 107656
Entry
107656            CDS       T01002                                 

Gene name
Krt9, EPPK, K9, Krt1-, Krt1-9
Definition
(RefSeq) keratin 9
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107656 (Krt9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107656 (Krt9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    107656 (Krt9)
   04147 Exosome [BR:mmu04147]
    107656 (Krt9)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107656 (Krt9)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107656 (Krt9)
  Exosomal proteins of other body fluids (saliva and urine)
   107656 (Krt9)
  Exosomal proteins of colorectal cancer cells
   107656 (Krt9)
  Exosomal proteins of melanoma cells
   107656 (Krt9)
SSDB
Motif
Pfam: Filament Peptidase_Mx HAUS2 DUF812 DUF4776 DUF6074 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 107656
NCBI-ProteinID: NP_957707
MGI: 96696
Ensembl: ENSMUSG00000051617
Vega: OTTMUSG00000002544
UniProt: Q6RHW0
Position
11; 11 D
AA seq 743 aa
MSCRQSSSSFWSSSSSCGGGGGRGGSGGSMRSSFSRSSRAGGGGGGRFNSSSGFSGGGFS
ACGGGGGGSFGSSYGGGYGGGFSTGSYSGMFGGGSGGGFGGGSGGGFGGGSGGGFGGGSG
GGEGGILNTNEKIVMQNLNSRLASYMEKVLELEESNTAMEKQIQDWYSKRGPKVFQKDNT
HYYDTIEDLKDRIVDLTVRNNKTLVDIDNTRMTMDDFRVKLEMEQSLRQGVEGDINGLKK
VLDDLVMAKSDLEILLDSLEDEKNALTKNHKEEMSQLTGQNDGDVNVEINVAPSTDLTRV
LNDMREEYEQLISKNRQDIEQHYESKMTQIEQQMTNSGQEMESNMKQVSQLQHTIQELNV
ELQTQLTTKSALEKALEDTKNRYCGQLQQIQEQISELEAQLAEIRAETECQSQEYSILLS
IKTRLEKEIETYRELLEGGQQDFESSGAGQIGFGSGKGRQRGSGGSYGGGSGGSYGGGSG
GSYGGGSGGSYGGGSGGSYGGGSGGSHGGKSGGSHGGGSGGSYGGESGGSHGGGSGGSYG
GGSGGSHGGKSGGGYGGGSSSGGGSGGSYGGGSGGSHGGGSGGSYGGGSGGSHGGKSGGG
YGGGSSSGGGSGGSYGGGSGGSHGGKSGGSYGGGSGGSYGGGSGGSHGGKSGGGYGGGSS
SGGGSGGSYGGGSGGSHGGKSGGSYGGGSSSGGGSGGSYGGGSGSGGGSGGSYGGGNRRP
SQSQSSSKSADCDDDSQEHKMRY
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgagttgcagacagagctcctcatctttctggagcagcagcagcagctgtggaggagga
ggaggcagagggggcagcggaggcagcatgcgatcttctttcagtcgctcctccagggct
ggtggaggaggaggaggccgctttaactcttccagtggctttagcgggggtggcttttcg
gcttgtggcggtggaggtggtggcagttttggctctagctatggtggagggtatggaggg
ggttttagtacagggagttacagcggtatgtttggtggaggttctggaggtggctttggt
ggtggctctggcggtggctttggtggtggctctggaggtggctttggtggtggctctgga
ggtggtgaaggcggtattctgaacaccaatgagaaaatcgttatgcagaacctcaattcc
cgtctggcctcttacatggagaaagtactagaactggaggagagcaacactgccatggag
aagcagatccaggactggtattcaaagagggggcccaaagtcttccagaaggacaacact
cattactatgacaccatcgaagacctgaaggacagaattgtggatctcacggtgaggaac
aacaaaactctcgtggacatcgacaatactcgcatgactatggatgacttcagagttaag
cttgagatggagcaaagcctgcgccaaggggtggaaggtgacattaatggcctgaagaag
gtgttggatgatctggttatggcgaaatctgatctggagatactgcttgatagtttggag
gatgagaagaatgcccttacgaagaaccacaaggaggagatgagccagttgacgggccag
aatgatggagatgttaatgtggagataaatgttgctcctagcacagatctcacccgggtc
ctcaatgacatgcgtgaggaatacgaacagctcatttctaagaaccgccaggacattgaa
caacactatgagtccaagatgacccagattgagcagcaaatgacaaatagtggccaagag
atggagagcaacatgaagcaagtgtcccagctccagcacactatccaggaactgaatgtg
gagctgcagactcagcttaccacgaaatcagccctggagaaggctttggaagacacaaag
aaccgctactgtggccagctgcagcagatccaggagcagatcagcgagttggaggcccag
cttgctgagatccgggcagaaactgaatgccagagtcaggaatacagcattctgctcagc
atcaagacacggctggagaaagaaattgagacttaccgggagctccttgaaggcggccag
caagactttgaatcgtctggagctggacaaattggctttggaagtggcaaaggaagacaa
agaggaagtggtggcagctatggaggaggaagtgggggcagctatggaggaggaagtggg
ggcagctatggaggaggaagtgggggcagctatggaggaggaagtggagggagctatgga
ggaggaagtgggggcagtcatggtggaaaaagtggaggcagtcatggaggaggaagtggg
ggcagctatggaggagaaagtgggggcagccatggaggaggaagtgggggcagctatggt
ggaggaagtgggggcagccatggtggaaaaagtggaggaggttatggaggaggaagcagc
tctgggggaggaagtggaggcagctatggaggaggaagtgggggcagccatggaggagga
agtgggggcagctatggtggaggaagtgggggcagccatggtggaaaaagtggaggaggt
tatggaggaggaagcagctctgggggaggaagtggaggcagctatggaggaggaagtggg
ggcagccatggtggaaaaagtgggggtagctatggaggaggaagtggtggcagctatgga
ggaggaagtgggggcagccatggtggaaaaagtggaggaggttatggaggaggaagcagc
tctgggggaggaagtggaggcagctatggaggaggaagtgggggcagccatggtggaaaa
agtggaggtagctatggaggaggaagcagttctgggggaggaagtggaggcagctatgga
ggaggaagtggttctggaggaggaagtgggggtagctatggtggaggaaatagaaggcca
tctcagtcccagtcctcctcaaagtctgcagactgcgatgatgattcacaagagcacaag
atgcgatactag

KEGG   Mus musculus (mouse): 16660
Entry
16660             CDS       T01002                                 

Gene name
Krt31, Ha, Ha1, Kha, Kha1, Krt1-, Krt1-1, MKHA-, MKHA-1
Definition
(RefSeq) keratin 31
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16660 (Krt31)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16660 (Krt31)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16660 (Krt31)
   04147 Exosome [BR:mmu04147]
    16660 (Krt31)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16660 (Krt31)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16660 (Krt31)
  Exosomal proteins of other body fluids (saliva and urine)
   16660 (Krt31)
  Exosomal proteins of colorectal cancer cells
   16660 (Krt31)
  Exosomal proteins of melanoma cells
   16660 (Krt31)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Lzipper-MIP1 Uso1_p115_C
Other DBs
NCBI-GeneID: 16660
NCBI-ProteinID: NP_034789
MGI: 1309993
Ensembl: ENSMUSG00000048981
Vega: OTTMUSG00000002219
UniProt: Q61765
Position
11 D; 11 63.39 cM
AA seq 416 aa
MPYNCCLPALSCRTSCSSRPCVPPSCHGCTLPGACNIPANVGNCNWFCEGSFNGNEKETM
QFLNDRLASYMEKVRQLERENAELECRIQERNQQQDPLVCPAYQAYFRTIEELQQKILCS
KSENARLVVQIDNAKLAADDFRTKYETELGLRQLVESDINGLRRILDELTLCKSDLEAQV
ESLKEELLCLKRNHEEEVNTLRCQLGDRLNVEVDAAPTVDLNRVLNETRCQYEAMVETNR
REVEEWFTTQTEELNKQVVSSSEQLQSCQAEIIELRRTVNALEIELQAQHCMRNSLENTL
TESEARYSSQLSQVQCLITNVESQLGEIRADLERQNQEYQVLLDVKARLECEINTYRGLL
ESEDCKLPCNPCATSNACGKPIGPCVSNPCVPCPPPAPCTPCVPRPRCGPCNSFVR
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgccatacaattgctgcctgccggccctgagctgccgcaccagctgctcctcccggccc
tgtgtgccccccagctgccatggctgcaccctgcctggggcctgcaacatccccgccaat
gtgggcaactgcaattggttctgtgagggctccttcaatggcaatgagaaggagaccatg
cagttcctgaatgaccgcctggcctcctatatggagaaggtgaggcagctggagagagag
aatgcagagctggaatgtaggatccaggagaggaaccagcagcaggaccccctggtgtgt
cctgcctaccaggcctacttcaggaccattgaggagttgcagcagaagatcctgtgcagc
aaatcagagaatgccaggttggtggtgcagatagataatgccaagctggctgcagacgac
ttcaggaccaagtatgagacagagctcggtctgcggcagctggtagagtcagacatcaac
ggcctgcgaaggatcttggatgagctgaccctgtgcaagtctgacctggaggcgcaggtg
gagtccctgaaggaggagctgctgtgtctcaagaggaaccatgaagaggaagtcaacacc
ctacgctgccagcttggagaccgcctcaacgtggaggtggacgctgctcccaccgtggac
ctgaaccgtgtgctcaacgagaccaggtgtcagtacgaggccatggtggaaaccaaccgc
cgggaagtggaggaatggttcaccacacagacagaggagctgaacaagcaggtggtgtcc
agctcagagcagctgcagtcctgccaagccgagatcatcgagctgagacgcacagtcaac
gccctggagatcgagctgcaggcccagcactgcatgagaaactctctggagaacaccctg
acagagagtgaggctcgctacagctctcagctgtcccaggtgcagtgcctgatcaccaac
gtggagtcccagcttggtgagatccgggctgacctggagcgtcagaaccaggagtaccag
gtgctgctggatgtcaaggcccggctggagtgtgagatcaacacgtataggggcctgctg
gagagcgaggactgcaagctaccttgcaacccctgtgccacaagcaatgcatgcggcaag
cccattgggccctgcgtctccaatccctgtgtcccctgcccaccccctgccccttgcaca
ccttgtgtcccacgtccccgctgtgggccatgcaactcctttgtacgctag

KEGG   Mus musculus (mouse): 16661
Entry
16661             CDS       T01002                                 

Gene name
Krt10, D130054E02Rik, K10, K1C1, Krt-1.1, Krt-1.10, Krt1-1, Krt1-10
Definition
(RefSeq) keratin 10
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16661 (Krt10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16661 (Krt10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16661 (Krt10)
   04147 Exosome [BR:mmu04147]
    16661 (Krt10)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16661 (Krt10)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16661 (Krt10)
  Exosomal proteins of other body fluids (saliva and urine)
   16661 (Krt10)
  Exosomal proteins of colorectal cancer cells
   16661 (Krt10)
  Exosomal proteins of melanoma cells
   16661 (Krt10)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 APG6_N Jnk-SapK_ap_N DUF4618 YabA DUF4407
Other DBs
NCBI-GeneID: 16661
NCBI-ProteinID: NP_034790
MGI: 96685
Ensembl: ENSMUSG00000019761
Vega: OTTMUSG00000004962
UniProt: P02535 A2A513
Position
11 D; 11 62.92 cM
AA seq 561 aa
MSVLYSSSSKQFSSSRSGGGGGGGSVRVSSTRGSLGGGYSSGGFSGGSFSRGSSGGGCFG
GSSGGYGGFGGGGSFGGGYGGSSFGGGYGGSSFGGGSFGGGGSFGGGSFGGGSYGGGFGG
GGFGGDGGSLLSGNEKVTMQNLNDRLASYMDKVRALEESNYELEGKIKEWYEKHGNSSQR
EPRDYSKYYKTIEDLKGQILTLTTDNANVLLQIDNARLAADDFRLKYENEVTLRQSVEAD
INGLRRVLDELTLSKSDLEMQIESLNEELAYLKKNHEEEMRDLQNVSTGDVNVEMNAAPG
VDLTQLLNNMRNQYEQLAEKNRKDAEEWFNQKSKELTTEIDSNIEQMSSHKSEITELRRT
VQGLEIELQSQLALKQSLEASLAETEGRYCVQLSQIQSQISALEEQLQQIRAETECQNAE
YQQLLDIKTRLENEIQTYRSLLEGEGSSSGGGGGRGGGSHGGSYGGSSGGGSYGGSSGGG
GSYGGSSGGGGSYGGGSSGGGSHGGSSGGGYGGGSSSGGAGGHGGSSGGGYGGGSSSGGQ
GGSGGFKSSGGGDQSSKGPRY
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgtctgttctatacagctccagcagcaagcagttctcttcctcccgcagtggaggagga
ggcggtggtggatccgtcagggtttccagcaccaggggctctcttggtggagggtatagc
tcaggaggcttcagcggtggctcttttagccgtgggagctctgggggaggttgctttggg
ggctcatcaggtggttacggaggttttggaggaggaggcagctttgggggaggctatgga
ggaagcagctttgggggaggctatggaggtagcagttttgggggtggcagcttcggtgga
ggtggcagcttcggtggaggcagctttggtggcggtagctatggaggaggctttggcggt
ggtggattcggaggagatggtggcagccttctctccggaaacgagaaggtgaccatgcag
aacctgaacgaccgcctggcctcctacatggacaaagtccgggctctggaagagtcaaac
tacgagctggagggtaaaatcaaggagtggtacgagaagcatggcaactcaagccagcga
gagccccgggactacagcaaatactacaaaaccatcgaggaccttaaggggcagatcctc
accctgacaactgacaatgccaacgtgctgctgcagattgacaatgcccgcctggcagct
gatgacttcaggctgaaatacgagaatgaggtgaccctgcgccagagcgtggaggccgac
atcaatggcctgcgcagggtactggatgagctgacccttagcaagtctgacctggaaatg
cagatcgaaagtctgaacgaagagctggcctacctaaagaagaaccacgaagaggaaatg
agagaccttcaaaatgtgtccactggtgatgtgaatgtggaaatgaacgctgccccaggg
gttgacctgactcagctgctgaacaacatgagaaaccaatacgaacaacttgcagaaaag
aatcgcaaggatgctgaagagtggttcaatcagaagagcaaggaactcaccacagaaatc
gacagcaacattgaacaaatgtccagccataagtctgaaatcactgaattgagacgtact
gttcagggtctggagattgaactacagtcccagctggccctgaaacaatcgctggaagcc
tccttggcagaaacagaaggtcgctactgcgtgcagctctcccagattcaaagccagatc
tccgccctggaggaacagctgcaacagattcgggctgagaccgagtgccagaacgccgag
taccaacaactcctagacatcaagacccgactggagaacgagattcagacctaccgcagc
ctgctagaaggagagggaagctccagcggtggcggcggcggacgcggcggcggcagccac
ggcggtagctacggcggaagctccggtggcggaagctacggcggaagttccggcggcggc
ggcagctacggcggaagttccggcggcggcggcagctacggcggcggaagctccgggggc
ggtagccacggaggcagttccggtggcggctacggcggcggaagttccagcggtggtgct
ggtggtcacggcggcagttccggtggcggctacggcggcggaagttccagcggaggccag
ggcggaagcggaggtttcaagtcttccggtggcggcgaccaatcatctaaaggaccaaga
tactaa

KEGG   Mus musculus (mouse): 16663
Entry
16663             CDS       T01002                                 

Gene name
Krt13, CK13, K13, Krt-1.1, Krt-1.13, Krt1-1, Krt1-13
Definition
(RefSeq) keratin 13
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16663 (Krt13)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16663 (Krt13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16663 (Krt13)
   04147 Exosome [BR:mmu04147]
    16663 (Krt13)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16663 (Krt13)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16663 (Krt13)
  Exosomal proteins of other body fluids (saliva and urine)
   16663 (Krt13)
  Exosomal proteins of colorectal cancer cells
   16663 (Krt13)
  Exosomal proteins of melanoma cells
   16663 (Krt13)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Bacillus_HBL Keratin_2_head ATG14 Jnk-SapK_ap_N Prefoldin RasGAP_C DUF1664
Other DBs
NCBI-GeneID: 16663
NCBI-ProteinID: NP_034792
MGI: 101925
Ensembl: ENSMUSG00000044041
Vega: OTTMUSG00000002539
UniProt: P08730
Position
11 D; 11 63.41 cM
AA seq 437 aa
MSCRFQSSSMSYGGGFGAGSCQLGGGRNISSCSSRFVTGGSAGGYGGGMSCGFGGGAGGG
FGGGFGGGFGGSYGGGFGGGFGDFGGVDGGLLSGNEKITMQNLNDRLASYLDKVRALEAA
NADLEVKIRDWHLKQSPASPERDYSAYYKTIEELRIKILEATTDNNRIILEIDNARLAAD
DFRLKYENELTLRQSVEADINGLRRVLDELTLAKTDLEMQIESLNEELAYLKKNHEEEMK
EFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEALAEKNRRDAEEWFQTKSAELNKEVS
SNAEMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLESTLAETECRYALQLQQIQGLIS
SIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMTGFNSGGNNTTT
SNGSPSSNSGRPDFRKY
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgagctgccgcttccagagttcctccatgagctatggaggtggtttcggagctggttct
tgccagcttggaggaggccgtaatatctcctcctgctcatctcggtttgtcactggaggg
tcagctggaggctatggagggggcatgagctgtggctttggtggaggagctggtggtggc
tttggaggtggctttggaggtggctttggaggtagctatggcggaggttttggcggtggc
tttggtgacttcggaggtgtcgatggtggcctcctctctggcaacgagaagatcaccatg
cagaacctcaatgaccgcctggccagctacctggataaggtgcgcgccttggaggcagcc
aatgccgacctggaggtgaagattcgtgactggcatctgaaacagagcccagctagtcca
gagcgggactacagtgcttattataagaccatcgaggagctccggatcaagattctggaa
gccaccacggacaacaaccggatcatcctggagattgacaatgccaggctggctgcagat
gacttcaggctcaagtacgaaaatgagctgaccttgcgccagagcgtggaggccgacatc
aacggcctgcgcagggtgctggatgagctgactctggctaagactgacctggaaatgcag
attgagagcctgaatgaagaactggcttacctgaagaagaaccacgaagaggagatgaag
gaattcagcaaccaggtagtaggccaggtcaatgtggagatggacgccacccctggcatt
gatctgacccgtgtgctggctgagatgagggagcagtatgaagccctggcagagaagaat
cggagggatgctgaggaatggttccagaccaagagtgcagagctgaacaaggaagtatcc
tccaacgctgaaatgatccagaccagcaagacagagatcacagaactcaggcgcacactc
cagggcctggagattgagctgcagtcccagctgagcatgaaagccggcctggaaagtacg
ttggcagagacagagtgccgctacgccctgcagctgcaacagatccaggggctcatcagc
agcatcgaggctcagctgagcgagctccgaagtgagatggagtgccagaaccaggaatac
aagatgctgttggacatcaaaacaaggctggaacaggagatcgccacctaccgcagcctg
ctagagggccaggatgctaagatgaccggcttcaactccggaggaaataacactactacc
tccaacgggtccccctcctccaattccggtcgcccagatttccgaaagtattaa

KEGG   Mus musculus (mouse): 16664
Entry
16664             CDS       T01002                                 

Gene name
Krt14, AI626930, CK-14, K14, Krt-1.1, Krt-1.14, Krt1-1, Krt1-14
Definition
(RefSeq) keratin 14
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16664 (Krt14)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16664 (Krt14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16664 (Krt14)
   04147 Exosome [BR:mmu04147]
    16664 (Krt14)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16664 (Krt14)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16664 (Krt14)
  Exosomal proteins of other body fluids (saliva and urine)
   16664 (Krt14)
  Exosomal proteins of colorectal cancer cells
   16664 (Krt14)
  Exosomal proteins of melanoma cells
   16664 (Krt14)
SSDB
Motif
Pfam: Filament TPR_5 Bacillus_HBL FlxA
Other DBs
NCBI-GeneID: 16664
NCBI-ProteinID: NP_058654
MGI: 96688
Ensembl: ENSMUSG00000045545
Vega: OTTMUSG00000002538
UniProt: Q61781
Position
11 63.43 cM; 11 D
AA seq 484 aa
MATCSRQFTSSSSMKGSCGIGGGSSRMSSILAGGSCRAPSTYGGMSVTSSRFSSGGACGI
GGGYGGSFSSSSFGGGLGSGFGGRFDGFGGGFGGGLGGGFGGGLGGGLGGGIGDGLLVGS
EKVTMQNLNDRLATYLDKVRALEEANTELEVKIRDWYQRQRPTEIKDYSPYFKTIEDLKS
KILAATVDNANVLLQIDNARLAADDFRTKFETEQSLRMSVEADINGLRRVLDELTLARAD
LEMQIESLKEELAYLKKNHEEEMASMRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKM
AEKNRKDAEEWFFSKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKAS
LENNLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIAT
YRRLLEGEDAHLSSSQFSSSSQFSSGSQSSRDVTSTNRQIRTKVMDVHDGKVVSTHEQVL
RTKN
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggccacctgcagccgccagttcacctcctccagctccatgaagggctcttgtggtatc
ggtggtggctctagccgcatgtcctccatcctggctggaggatcctgccgggctcccagc
acctacgggggcatgtcggttacctcctctcgcttctcctctgggggagcctgtgggatt
ggaggtggctatggtgggagcttcagcagcagcagttttggtggaggacttggtagtgga
tttggtggtcgatttgatggatttggtggtggttttggtggtggtcttggtggtggtttt
ggtggtggtcttggtggtggtcttggcggtggtattggtgatgggctcctggtgggcagt
gagaaagtgaccatgcagaacctcaatgaccgcctggccacctacctggacaaggtgcgt
gccctggaagaggccaacactgaactggaggtgaagattcgggactggtaccagaggcag
cggcccactgagatcaaagactacagcccctacttcaagaccatcgaggacctgaagagc
aagatcctggcagccaccgtggacaatgccaatgtcctcctgcagatcgacaatgcccgc
ctggctgccgatgacttccggaccaagtttgagacggagcagagcctgcgcatgagcgtg
gaggccgacatcaatggcctgcgcagggtgctggatgagctgaccctggccagagccgac
ctggagatgcagattgagagcctcaaggaggagctggcctacctgaagaagaaccacgag
gaggaaatggcctccatgagaggccaggtgggtggagacgtcaatgtggagatggacgcc
gcccctggtgtggacctgagccgcatcctgaacgagatgcgggatcagtacgagaagatg
gcggagaagaaccgcaaggatgctgaggaatggttcttcagcaagacagaggagctgaac
cgcgaggtggccaccaacagcgagctggtgcagagcggcaagagtgagatttctgagctc
cggcgcaccatgcagaacctggagatcgagctgcagtcccagctcagcatgaaagcatcc
ctggagaataacctggaggagaccaaaggccgttactgcatgcagctggcccagatccag
gagatgatcggcagtgtggaggagcagctggctcagctgcgctgcgagatggagcagcag
aaccaggagtacaaaatcctgctggatgtgaagacaaggctggagcaggagatcgccacc
taccgccgtctgctggagggagaggacgcccacctttcatcttcccaattctcctcatcc
tctcaattctcctctggctctcagtcatccagagatgtgacctccaccaaccgccagatc
cgcaccaaggtcatggatgtgcacgatggcaaggtggtctccacccacgagcaggtcctg
cgcaccaagaactaa

KEGG   Mus musculus (mouse): 16665
Entry
16665             CDS       T01002                                 

Gene name
Krt15, AI528832, K15, Krt1-1, Krt1-15
Definition
(RefSeq) keratin 15
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16665 (Krt15)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16665 (Krt15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16665 (Krt15)
   04147 Exosome [BR:mmu04147]
    16665 (Krt15)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16665 (Krt15)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16665 (Krt15)
  Exosomal proteins of other body fluids (saliva and urine)
   16665 (Krt15)
  Exosomal proteins of colorectal cancer cells
   16665 (Krt15)
  Exosomal proteins of melanoma cells
   16665 (Krt15)
SSDB
Motif
Pfam: Filament ATG14 TPR_MLP1_2 Bacillus_HBL DUF4618 Jnk-SapK_ap_N FAM117 DUF4407 DUF1664 Keratin_2_head
Other DBs
NCBI-GeneID: 16665
NCBI-ProteinID: NP_032495
MGI: 96689
Ensembl: ENSMUSG00000054146
Vega: OTTMUSG00000002551
UniProt: Q61414 B1AQ77
Position
11 D; 11 63.41 cM
AA seq 456 aa
MATTFLQTSSTFGGSSTRGASLRAGGGSFGGGSLYGGGGSRSISASSARFVSSGAGGGFG
GGMSCGFGGGFGGGFGGGFGGGFGDFGGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALE
QANTELEVKIRDWYQKQSPASPDRDYSHYFKTMEEIRDKILAATIDNSRVVLEIDNARLA
ADDFRLKYENELTLRQGVEADINGLRRVLDELTLARTDLEMQIEQLNEELAYLKKNHEEE
MKEFSSQLAGQVNVEMDAAPGVDLTRMLAEMREQYEAIAEKNRRDVEAWFFSKTEELNKE
VASNTEMIQTSKTEITDLRRTLQGLEIELQSQLSMKAGLENSLAEVECRYATQLQQIQGV
ITGLETQLSELRCEMEAQNQEYNMLLDIKTRLEQEIATYRNLLEGQDAKMAGIGVREVSL
GGSSGGGGSSSSSSNFHISVEESVDGKVVSSRKREI
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggccaccacattcttgcaaacgtcttccacttttggaggcagctctacccgaggggct
tccctccgtgctgggggaggcagctttggtggagggagtctctatgggggaggtggaagc
cgaagtatctctgcttcttctgctaggtttgtctcctcgggggcaggagggggctttggg
ggtggcatgagttgtggctttggtggtggttttggtggaggctttggtgggggttttggc
ggtggcttcggtgattttggtggtggcgatggaggtctcctctctggcaatgagaaggtg
accatgcagaaccttaatgaccgcctggcctcctacctggacaaggtgcgtgccctagag
caggccaacactgagctggaggtgaagatccgagattggtaccagaagcagagcccagcc
agtccagatcgggactacagccattactttaagaccatggaagagatccgggacaaaatt
ctggctgccaccattgacaactcgcgcgttgtcctggagattgacaatgccaggctggcg
gcggacgacttcaggctcaagtatgagaatgagctgaccctgcgtcagggcgtggaggcc
gacatcaacgggctgcgccgggtgctggatgagctgaccctggccaggaccgacctggag
atgcagattgagcagctgaacgaggagctggcttacctgaagaagaaccatgaggaggag
atgaaggaattcagcagtcaactggctggccaggtcaatgtggaaatggacgcagcaccc
ggggtggacctgacccgcatgctggcagagatgagggagcagtatgaagctattgcagag
aaaaaccgtcgggatgtagaggcctggttcttcagtaagactgaagagctgaacaaggag
gtggcgtctaacacagaaatgatccagaccagcaagacggagatcacagacctgagacgg
accctgcaggggctagagattgagttgcagtctcagctcagcatgaaagccgggctggag
aactctctggcagaggtggagtgccgctatgccacacagctgcagcagatccagggggtc
attaccggtctggagactcagctgagtgagctccgctgtgagatggaggctcagaaccag
gagtacaacatgctgctggacatcaagactcggctggaacaggagatcgccacttaccgg
aacctgctcgagggccaggatgctaagatggctggtattggtgtcagagaagtatccctg
ggaggaagcagcggtggcggtggcagcagtagcagcagcagcaatttccatatcagtgtg
gaggaatcagtggatggaaaagtggtttcttcccgtaagagagaaatctaa

KEGG   Mus musculus (mouse): 16666
Entry
16666             CDS       T01002                                 

Gene name
Krt16, AI324768, CK-16, K16, Krt1-1, Krt1-16
Definition
(RefSeq) keratin 16
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16666 (Krt16)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16666 (Krt16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16666 (Krt16)
   04147 Exosome [BR:mmu04147]
    16666 (Krt16)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16666 (Krt16)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16666 (Krt16)
  Exosomal proteins of other body fluids (saliva and urine)
   16666 (Krt16)
  Exosomal proteins of colorectal cancer cells
   16666 (Krt16)
  Exosomal proteins of melanoma cells
   16666 (Krt16)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Sec2p
Other DBs
NCBI-GeneID: 16666
NCBI-ProteinID: NP_032496
MGI: 96690
Ensembl: ENSMUSG00000053797
Vega: OTTMUSG00000002540
UniProt: Q9Z2K1 Q3SYP5
Position
11; 11 D
AA seq 469 aa
MATCSRQFTSSSSMKGSCGIGGGSSRMSSILAGGSCRAPSTCGGMSVTSSRFSSGGVCGI
GGGYGGSFSSSSFGGGLGSGFGGRFDGFGGGFGAGLGGGLGGGIGDGLLVGSEKVTMQNL
NDRLATYLDKVRALEEANRDLEVKIRDWYQRQRPTEIKDYSPYFKTIEDLKSKIIIATQE
NAQFTLQIDNARLAADDFRTKYENELFLRQSVEGDINGLRKVLDELTLSRADLEMQIENL
REELAFLKKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKNRRDV
EAWFLRKTEELNKEVASNSDLIQSNRSEVAELRRVFQGLEIELQSQLSMKASLENSLEET
KGRYCMQLSQIQGLISSVEEQLAQLRCEMEQQSQEYNILLDVKTRLEQEIATYRRLLDGE
NIHSSSQHSSGQSYSSREVFSSSSRQPRSILKEQGSTSFSQSQSQSSRD
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggccacctgcagccgccagttcacctcctccagctccatgaagggctcctgtggcatc
ggtggtggctctagccgcatgtcctccatcctggctggaggatcctgccgggctcccagc
acctgcgggggcatgtcagttacctcctctcgcttctcctctgggggagtctgtgggatt
ggaggtggctatggtgggagcttcagcagcagcagttttggtggaggacttggtagtgga
tttggtggtcgatttgatggatttggtggtggttttggtgctggtcttggtggtggtctt
ggcggtggtattggtgatgggctcctggtgggcagtgagaaagtgaccatgcagaacctc
aatgaccgcctggccacctacctggacaaggtgcgtgccctggaagaggccaacagagac
ctggaggtgaagatccgggactggtaccagaggcagcggcccactgagatcaaagactac
agcccctacttcaagaccattgaggacctgaagagcaagatcattattgccacccaggag
aatgcacagttcactttgcagattgacaatgccaggctggcagctgatgacttcaggacc
aagtacgagaatgagctgttcttgcggcagtccgtggagggtgacatcaatggcctgcgc
aaggtgctagatgagctgaccctgtccagagctgacctggaaatgcagattgaaaacctc
agagaagagctggccttcctgaagaagaaccatgaggaggagatgcttgccttgaggggt
cagactggtggggacgtcaatgtggagatggacgcagcccccggtgtggacctcagccgc
attctgaatgagatgagggaccagtatgagcagatggcagagaagaaccgcagagatgtg
gaggcctggttcctgagaaagactgaggagctgaacaaagaggtggcctctaacagtgat
ctaatccagagcaaccgcagcgaggtggctgagctccgcagggtgttccagggcctggag
attgaactgcagtcccagctcagcatgaaagcatccttggagaacagcctagaagagacc
aaaggcagatactgtatgcagctgtcccagatccagggtttgatcagcagtgtggaggag
cagctggctcagcttcgctgcgagatggagcagcagagccaggagtacaacatcttgttg
gatgtgaagacaaggctggagcaggagatcgccacctaccgccgtctgctggatggcgag
aatatccactcctcctcacagcactcctctggacagtcctattcttctcgagaagtcttc
tcctcatcctcccgccagccccggtccatcctcaaggagcaaggttcaaccagcttcagc
cagagccaaagtcagagttccagggactaa

KEGG   Mus musculus (mouse): 16667
Entry
16667             CDS       T01002                                 

Gene name
Krt17, K17, Krt1-1, Krt1-17
Definition
(RefSeq) keratin 17
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16667 (Krt17)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16667 (Krt17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16667 (Krt17)
   04147 Exosome [BR:mmu04147]
    16667 (Krt17)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16667 (Krt17)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16667 (Krt17)
  Exosomal proteins of other body fluids (saliva and urine)
   16667 (Krt17)
  Exosomal proteins of colorectal cancer cells
   16667 (Krt17)
  Exosomal proteins of melanoma cells
   16667 (Krt17)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 DHR10 DUF1664 SDH_beta DUF885
Other DBs
NCBI-GeneID: 16667
NCBI-ProteinID: NP_034793
MGI: 96691
Ensembl: ENSMUSG00000035557
Vega: OTTMUSG00000002546
UniProt: Q9QWL7
Position
11 D; 11 63.44 cM
AA seq 433 aa
MTTTIRQFTSSSSIKGSSGLGGGSSRTSCRLSGSLGAGSCRLGSASGLGSALGSNSYSSC
YSFGTGSGYGGNFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWY
QKQAPGPARDYSAYYHTIEDLKNKILVATVDNASILLQIDNARLAADDFRTKFETEQALR
MSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVE
MDAAPGVDLSRILSEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEI
SELRRTMQALEIELQSQLSMKASLEGSLAETENRYCVQLSQIQGLIGSVEEQLAQLRCEM
EQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKPKEPVTTRQVRTIVEEVQDGK
VISSREQVHQTTR
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaccaccaccatccgccagtttacctcctccagctctatcaagggctcctctggcctg
ggtggaggttcatctcggacctcctgccgactgtctggcagcctgggtgcaggctcctgc
aggctggggtcagctagtggcctgggtagtgctcttgggagcaacagttattccagctgc
tacagctttggcactggcagtggttatggaggcaactttgggggtgtcgatgggctgctg
gctggaggggagaaggccaccatgcagaacctcaatgaccgcctggcctcctacctggac
aaggtgcgtgccctggaagaggccaacactgagctggaggtgaagatccgagattggtac
cagaagcaggccccggggccagccagagactacagcgcttattaccataccattgaggat
ctgaagaacaagatccttgtggccaccgtggacaatgccagcatcctgctccagattgac
aatgctcgtctggcagccgatgacttccgtaccaagtttgagacagagcaggctctgcgc
atgagcgtggaggccgacatcaatggcctgcgccgggtgctggatgagctgaccctggcc
agagccgacctggagatgcagattgagaatctcaaggaggagctggcctacctgaagaag
aaccacgaggaggagatgaatgctctgagaggccaggtgggcggcgaaatcaacgtggag
atggatgccgctcccggtgtggacctgagccgcatcctgtcagagatgcgtgatcagtac
gagaagatggcggagaagaaccgcaaggatgccgaagactggttcttcagcaagaccgag
gagctgaaccgcgaggtggccaccaacagcgagctggtgcagagcggcaagagcgagatc
tccgagctcaggcgcaccatgcaggccctggagattgagctgcagtcccagctcagcatg
aaagcatctctggagggcagcctggcagagacagagaaccgctactgcgtgcagctgtct
cagatccaggggctgatcggcagtgtggaggagcagctggctcagctgcgctgcgagatg
gagcagcagaaccaggagtacaagatcctgctggatgtgaagacaaggctggagcaggag
atcgccacctaccgccgtctgctggagggagaggatgcccacctgactcagtacaagcca
aaagaacctgtgaccacccgccaggtgcgcaccattgtggaagaagttcaggatggcaag
gtcatctcatcccgggaacaggtgcaccagaccacccgttaa

KEGG   Mus musculus (mouse): 16668
Entry
16668             CDS       T01002                                 

Gene name
Krt18, CK18, K18, Krt1-1, Krt1-18
Definition
(RefSeq) keratin 18
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16668 (Krt18)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16668 (Krt18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16668 (Krt18)
   04147 Exosome [BR:mmu04147]
    16668 (Krt18)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16668 (Krt18)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16668 (Krt18)
  Exosomal proteins of other body fluids (saliva and urine)
   16668 (Krt18)
  Exosomal proteins of colorectal cancer cells
   16668 (Krt18)
  Exosomal proteins of melanoma cells
   16668 (Krt18)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 DUF4407 Laminin_II
Other DBs
NCBI-GeneID: 16668
NCBI-ProteinID: NP_034794
MGI: 96692
Ensembl: ENSMUSG00000023043
UniProt: P05784
Position
15 F2; 15 57.22 cM
AA seq 423 aa
MSFTTRSTTFSTNYRSLGSVRTPSQRVRPASSAASVYAGAGGSGSRISVSRSVWGGSVGS
AGLAGMGGIQTEKETMQDLNDRLASYLDKVKSLETENRRLESKIREHLEKKGPQGVRDWG
HYFKIIEDLRAQIFANSVDNARIVLQIDNARLAADDFRVKYETELAMRQSVESDIHGLRK
VVDDTNITRLQLETEIEALKEELLFMKKNHEEEVQGLEAQIASSGLTVEVDAPKSQDLSK
IMADIRAQYEALAQKNREELDKYWSQQIEESTTVVTTKSAEIRDAETTLTELRRTLQTLE
IDLDSMKNQNINLENSLGDVEARYKAQMEQLNGVLLHLESELAQTRAEGQRQAQEYEALL
NIKVKLEAEIATYRRLLEDGEDFSLNDALDSSNSMQTVQKTTTRKIVDGRVVSETNDTRV
LRH
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgagcttcacaactcgctccaccaccttctccaccaactaccggtccctgggctctgtg
cgaactcccagccagcgggtccggcctgccagcagcgcagccagcgtctatgcaggtgct
gggggctccgggtcccggatatccgtgtcccgctctgtctggggtggctctgtggggtcc
gcaggcctggcgggaatgggtggaatccagaccgagaaggagaccatgcaagacctgaac
gatcgcctggccagctacctagacaaggtgaagagcctggaaactgagaacaggagactg
gagagcaaaatccgggaacatctggagaagaaggggccccagggcgtcagagactggggc
cactacttcaagatcatcgaagacctgagggctcagatctttgcgaattctgtggacaat
gcccgcatcgtcttgcagatcgacaatgcccgccttgccgccgatgactttagagtcaag
tatgagacagaactagccatgcgccagtctgtggagagcgacatccatggactccgcaag
gtggtagatgacaccaacatcacaaggctgcagctggagacagaaatcgaggcactcaag
gaagaacttctgttcatgaagaagaatcatgaagaggaagtccaaggtctggaagcccag
attgccagctctggattgactgtggaagtggatgcccccaaatctcaggacctcagcaag
atcatggcggacatccgcgcccagtatgaagcgctggctcagaagaaccgcgaggaactg
gacaagtactggtctcagcagattgaggagagtaccacagttgtcaccaccaagtctgcc
gaaatcagggacgctgagaccacactcacggagctgagacgcaccctccagaccttggag
attgacttggactccatgaaaaaccagaacatcaacttggagaacagcctcggggatgtg
gaggcccgatacaaggcacagatggagcagctcaatggggtccttctgcatctggagtca
gagctggcacaaactcgggcagagggccagcgccaggcccaggaatatgaagccctcttg
aacatcaaggtgaagcttgaggcagagattgccacctaccgccgcttgctggaggatgga
gaagatttcagtctcaacgatgccctggactccagcaactccatgcaaactgtgcagaag
acaactacccgtaagatcgtggatggcagagtggtgtccgagactaatgacaccagagtt
ctgaggcactga

KEGG   Mus musculus (mouse): 16669
Entry
16669             CDS       T01002                                 

Gene name
Krt19, AI663979, CK-19, End, EndoC, K19, Krt-1.1, Krt-1.19, Krt1-1, Krt1-19
Definition
(RefSeq) keratin 19
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16669 (Krt19)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16669 (Krt19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16669 (Krt19)
   04147 Exosome [BR:mmu04147]
    16669 (Krt19)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16669 (Krt19)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16669 (Krt19)
  Exosomal proteins of other body fluids (saliva and urine)
   16669 (Krt19)
  Exosomal proteins of colorectal cancer cells
   16669 (Krt19)
  Exosomal proteins of melanoma cells
   16669 (Krt19)
SSDB
Motif
Pfam: Filament DivIC POX Bacillus_HBL BRE1 TPR_MLP1_2 DHHA1 DUF4407 Prefoldin Taxilin Lectin_N RasGAP_C
Other DBs
NCBI-GeneID: 16669
NCBI-ProteinID: NP_032497
MGI: 96693
Ensembl: ENSMUSG00000020911
Vega: OTTMUSG00000002545
UniProt: P19001 B1AQ78
Position
11 D; 11 63.42 cM
AA seq 403 aa
MTSYSYRQTSAMSSFGGTGGGSVRIGSGGVFRAPSIHGGSGGRGVSVSSTRFVTSSSGSY
GGVRGGSFSGTLAVSDGLLSGNEKITMQNLNDRLASYLDKVRALEQANGELEVKIRDWYQ
KQGPGPSRDYNHYFKTIEDLRDKILGATIDNSKIVLQIDNARLAADDFRTKFETEHALRL
SVEADINGLRRVLDELTLARTDLEMQIESLKEELAYLKKNHEEEITALRSQVGGQVSVEV
DSTPGVDLAKILSEMRSQYEIMAEKNRKDAEATYLARIEELNTQVAVHSEQIQISKTEVT
DLRRTLQGLEIELQSQLSMKAALEGTLAETEARYGVQLSQIQSVISGFEAQLSDVRADIE
RQNQEYKQLMDIKSRLEQEIATYRSLLEGQEAHYNNLPTPKAI
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgacttcctatagctatcgccagacctcagctatgtcttcctttgggggtacgggcggg
ggttcagtacgcattgggtcagggggtgttttccgcgcacccagcatccacgggggctca
ggtggccgcggcgtgtccgtgtcctccacccgcttcgtgacctcgtcctccgggagctat
ggcggagtccgcggtggaagttttagtgggaccctggctgtgtctgatgggctgctgtct
ggcaatgagaagatcaccatgcaaaacctcaatgatcgtctcgcctcctacttggacaag
gtgcgcgccctagagcaggccaatggcgagctggaggtgaagatccgcgactggtaccag
aagcagggacccggaccctcccgagattacaaccactactttaagaccatcgaggacttg
cgcgacaagattcttggtgccaccattgacaactccaagattgtcctacagattgacaat
gctcgcctggctgcagatgacttcagaaccaagtttgagacagaacacgccttgcgtctg
agcgtggaggccgacatcaacggcctgcgccgggtgctggatgagctgactctggccagg
actgacctggagatgcagattgagagcctgaaggaggagctggcctacctgaagaagaac
catgaggaggaaattactgccctgaggagccaggtgggtggccaggtcagtgtggaggtg
gattccactcccggtgtcgacctagccaagatcctgagtgagatgagaagtcagtatgag
atcatggccgagaagaaccggaaggatgctgaagccacctaccttgctcggattgaggag
ctgaacacccaggtcgccgtccactctgagcagatccagataagcaagaccgaagtcacg
gaccttcgacggaccctccagggccttgagattgagctgcagtcccagctcagcatgaaa
gctgccctggaaggcacgctggcagagacggaggcccgttatggagtccagctgtcacag
atccagagcgtgatcagcggttttgaagcccagctgagcgacgtgcgtgccgacatagag
cgccagaaccaggagtataagcagctcatggacatcaagtccaggctggagcaggagatc
gccacctaccgcagcctgctggagggccaggaagcccactacaacaatctgcccaccccc
aaggccatctga

KEGG   Mus musculus (mouse): 16670
Entry
16670             CDS       T01002                                 

Gene name
Krt32, Ha3, Hka2, K32, Krt1-, Krt1-2, Krtha2, mHa
Definition
(RefSeq) keratin 32
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16670 (Krt32)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16670 (Krt32)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16670 (Krt32)
   04147 Exosome [BR:mmu04147]
    16670 (Krt32)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16670 (Krt32)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16670 (Krt32)
  Exosomal proteins of other body fluids (saliva and urine)
   16670 (Krt32)
  Exosomal proteins of colorectal cancer cells
   16670 (Krt32)
  Exosomal proteins of melanoma cells
   16670 (Krt32)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 DUF5082 DUF2312 Baculo_PEP_C Lzipper-MIP1 ERM WCOB Topoisom_I_N Jnk-SapK_ap_N DUF3251 Bacillus_HBL
Other DBs
NCBI-GeneID: 16670
NCBI-ProteinID: NP_001152846
MGI: 1309995
Ensembl: ENSMUSG00000046095
Vega: OTTMUSG00000002216
UniProt: Q62168 B1ATJ5
Position
11 D; 11 63.4 cM
AA seq 453 aa
MPSSCCVTNTSSASLKSSARPSSVCSSNMGSRSELCLGYVCQPLQCMPSVCMPTTYRPAS
CLSKTYLSSSCQPSNRRPTGCISSSMGTYGLFCEGAFNGNEKETMQVLNDRLANYLEKVR
QLEKENAELEGKIQDVYQGQVLTMCPDYQSYFQTIEELQQKVLCTKAENARMIVHIDNAK
LAADDFRTKYETELALRQLVEADTNGLRRILDELTLNKADLEAQVESLKEELLCLKRNHE
EEVGVLRQQLGDRLNIEVDAAPPVDLTRMLEEMRCQYETMVETNHRDVEEWFNMQMEELN
KQVATSSEQLQSYQSDIIDLRRTVNTLEIELQAQHSLRDSLENTLGETEGRFTSQLSQMQ
CMITNVESQLSDIRCDLERQNQEYKVLLDVKARLECEIDTYRGLLESEDSKLPCNPCSTP
SCQPCAPSPGVSRTVCVPHTVCVPCSPCLQTRY
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgccatccagctgctgtgtcaccaacacctcatcagcatctctcaagagctcggcacgg
ccttcctccgtctgttccagtaacatgggcagcaggtccgagctgtgcctgggttatgtc
tgccagccgctgcagtgcatgccctctgtctgcatgccgaccacctacaggccagccagc
tgcctttctaagacctacttgtccagctcttgccaacccagcaaccgccggccaacgggt
tgcatctctagctccatggggacctatggcctgttctgtgagggtgccttcaatggcaat
gagaaagagaccatgcaggtcctgaatgaccgtctggccaactacctggagaaggtgagg
cagctggagaaagagaatgcagagctggagggcaagatccaagatgtctaccaggggcag
gtgctgaccatgtgtcctgactaccagtcctacttccagaccatcgaagagctgcagcaa
aaggttctgtgcaccaaggctgagaatgcaagaatgatcgtgcacatcgacaatgccaag
ctggctgcagatgacttcagaaccaagtatgaaacagagctggccctaagacagctggta
gaagcagacaccaatggcctgcgcaggatcctggatgagctaacccttaataaggctgat
ctagaggctcaagtagagtccctgaaggaggaacttctgtgcctcaagaggaaccatgaa
gaggaagttggtgtccttcgacaacagctcggggaccgccttaacattgaggtagatgct
gcacctcccgtggacctaaccaggatgctggaggagatgagatgtcagtatgagaccatg
gtggaaaccaaccacagggacgtggaggaatggttcaatatgcagatggaggagcttaac
aagcaggtggccacaagctctgagcagcttcagagctaccaatcagacatcattgacctg
agacgaacagtcaatactctggagatagaactgcaggctcagcacagcctgagagactcc
ctggaaaacacgctgggggagacagagggccgcttcacctcccagctgtcccagatgcaa
tgcatgatcaccaatgtggagtcccagctgtctgacatccgctgtgacctggagagacag
aaccaagagtacaaggtgttgctggatgtcaaggcccggctggagtgtgagattgacacg
tacaggggcctgctggagagtgaggacagcaagctaccctgtaacccttgctccactccc
tcctgccagccttgtgcaccctctcctggggtatcccgcaccgtctgtgtgccccacact
gtttgtgtgccttgttcaccctgcctacagacccgctactga

KEGG   Mus musculus (mouse): 16671
Entry
16671             CDS       T01002                                 

Gene name
Krt33b, Ha, Ha3, Ha4, Krt1-, Krt1-3, mHa, mHa3
Definition
(RefSeq) keratin 33B
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16671 (Krt33b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16671 (Krt33b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16671 (Krt33b)
   04147 Exosome [BR:mmu04147]
    16671 (Krt33b)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16671 (Krt33b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16671 (Krt33b)
  Exosomal proteins of other body fluids (saliva and urine)
   16671 (Krt33b)
  Exosomal proteins of colorectal cancer cells
   16671 (Krt33b)
  Exosomal proteins of melanoma cells
   16671 (Krt33b)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Lzipper-MIP1 DUF5082 SKA1 DUF1664
Other DBs
NCBI-GeneID: 16671
NCBI-ProteinID: NP_038598
MGI: 1309991
Ensembl: ENSMUSG00000057723
Vega: OTTMUSG00000002195
UniProt: Q61897
Position
11 D; 11 63.37 cM
AA seq 404 aa
MPYNCCLPAMSCRTSCSSRPCVPPSCHGCTLPGACNIPANVGNCNWFCEGSFNGNERETM
QFLNDRLASYMEKVRQLERENAELECKIQERNQQQDPLVCPAYQAYFRTIEELQQKILCG
KSENGRLVVQIDNAKLAADDFRTKYESELSLRQLVESDLNGLRRILDELTLCKSDLEAQV
ESLRQELLCLKQNHEEEVNTLRCQLGDRLNVEVDAAPTVDLNRVLNETRCQYEALVETNR
REVEEWFTTQTEELNKQVVSSSEQLQSCQAEIIELRRTVNALEIELQAQHSMRNSLENTL
AESEARYSSQLSQVQCLITNVESQLGEIRADLERQNQEYQVLLDVKARLECEINTYRGLL
ESEDCKLPCNPCATTNACDKPIGPCVTNPCVTRSRCGPCNSFGC
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgccatacaactgctgcctgcccgccatgagctgccgcaccagctgctcttcccggccc
tgcgtgccccccagctgccatggctgcaccctgcccggggcctgcaacatccccgccaat
gtgggcaactgcaattggttctgtgagggctccttcaatggcaatgagagggagaccatg
cagttcctgaatgaccgcctggcctcctatatggagaaggtgaggcagctggagagagag
aatgcagagctggaatgtaagatccaagagaggaaccagcagcaggaccccctggtgtgt
cctgcctaccaggcctacttcaggaccattgaggagctgcagcagaagattctctgtggc
aagtctgagaacggcaggctggtggtgcagatcgacaatgccaagctggctgctgatgac
ttcaggaccaagtatgagtcagagctgtccctgcggcagctggtggagtcagacctcaat
ggcctgcgcaggatcctggacgaactgaccctctgcaagtctgatctggaggcacaggtg
gagtccctgaggcaggagctgctgtgtctcaagcaaaaccatgaggaggaagtcaacacc
ctgcgctgccagcttggagaccgcctcaacgtagaggtggacgctgctcccaccgtggac
ctgaaccgagtgctcaacgagaccaggtgtcagtacgaggccctggtggaaaccaaccgc
cgggaagtggaggaatggttcaccacacagacagaggagctgaacaagcaggtggtgtct
agctcagagcagctgcagtcctgccaggcagagatcatcgagctgagacgcacagtcaat
gccctggagatcgagctgcaggcccagcacagcatgagaaactctctggagaataccctg
gcagagagtgaggctcgctacagctctcagctgtcccaggtgcagtgcctgatcaccaac
gtggagtcccagcttggtgagatccgggctgacctggagcgtcagaaccaggagtaccag
gtgttgctggatgtcaaggcccggctggagtgtgagatcaacacgtataggggcctgctg
gagagcgaggactgcaagctgccctgcaacccctgtgccaccaccaatgcctgtgacaag
cccattggaccctgtgtcacaaacccttgtgtcacacgctcccgatgtggaccctgcaat
tcctttggctgctaa

KEGG   Mus musculus (mouse): 16672
Entry
16672             CDS       T01002                                 

Gene name
Krt34, 4733401E01Rik, Ha2, K34, Krt1-, Krt1-4
Definition
(RefSeq) keratin 34
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16672 (Krt34)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16672 (Krt34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16672 (Krt34)
   04147 Exosome [BR:mmu04147]
    16672 (Krt34)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16672 (Krt34)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16672 (Krt34)
  Exosomal proteins of other body fluids (saliva and urine)
   16672 (Krt34)
  Exosomal proteins of colorectal cancer cells
   16672 (Krt34)
  Exosomal proteins of melanoma cells
   16672 (Krt34)
SSDB
Motif
Pfam: Filament ERM
Other DBs
NCBI-GeneID: 16672
NCBI-ProteinID: NP_081839
MGI: 1309994
Ensembl: ENSMUSG00000043485
Vega: OTTMUSG00000002178
UniProt: Q9D646
Position
11 D; 11 63.38 cM
AA seq 392 aa
MSCESCLPALSCRTSCSSRPCVPPSCHGCTLPGACNIPANVGNCNWFCEGSFNGNEKETM
QFLNDRLASYMEKVRQLERENAELECRIQERNQQQDPLVCPAYQAYFRTIEELQQKILCA
KSENARLVVQIDNAKLASDDFRTKYQTELSMRQLVEADINSLRRILDELTLCKSDLEAQV
ESLREELLCLKKNHEEEVNTLRCQLGDRLNVEVDAAPTVDLNRVLNETRCQYEALVETNR
REVEEWFTTQSEELNKQVVSSSEQLQSCQAEIIELRRTVNALEIELQAQHCMRNSLENTL
TESEARYSSQLSQVQCLITNVESQLGEIRADLERQNQEYQVLLDVRARLECEINTYRSLL
ESEDCNLPCNPCATTNASGSCCGPCGSSKRCC
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtcctgtgagtcttgcctgcccgccctgagctgccgcaccagctgctcctcccggccc
tgcgtgccccccagctgccatggctgcaccctgcccggggcctgcaacatccccgccaat
gtgggcaactgcaattggttctgtgagggctccttcaatggcaatgagaaggagaccatg
cagttcctgaatgaccgcctggcctcctatatggagaaggtgaggcagctggagagagag
aatgcagagctggaatgtaggatccaggagaggaaccagcagcaggaccccctggtgtgt
cctgcctaccaggcctacttcaggaccattgaggagctgcagcagaagattctgtgtgct
aagtctgagaacgccaggctggtcgtgcagatcgacaatgccaagctggcctctgatgac
ttcaggaccaagtaccagactgagctgtccatgaggcagctggtggaggctgacatcaac
agcctgcgcaggatcctggatgagctgaccctctgcaagtctgacttggaggctcaggtg
gagtctctgagggaggagctgctgtgcctcaagaagaaccacgaggaggaagtcaacacc
ctgcgctgccagcttggagaccgcctcaacgtggaggtggacgctgctcccaccgtggac
ctgaaccgagtgctcaacgagaccaggtgtcagtacgaggccctggtggaaaccaaccgc
cgggaagtggaggaatggttcaccacacagtcagaggagctgaacaagcaggtggtgtcc
agctcagagcagctacagtcctgccaggctgagatcatcgagctaagacgcacagtcaac
gccctggagatcgagctgcaggcccagcactgcatgagaaactctctggagaacaccctg
acagagagtgaggctcgctacagctctcagctgtcccaggtgcagtgcctgatcaccaac
gtggagtctcagcttggtgagatccgggctgacctggagcgtcagaaccaggagtaccag
gtgctgctggatgtccgggccaggctggagtgtgagatcaacacgtacaggagcctgctg
gagagcgaggactgcaacctcccctgcaacccatgcgccaccaccaatgctagtggcagt
tgctgtggaccttgcggcagctcaaagcgttgctgttaa

KEGG   Mus musculus (mouse): 16673
Entry
16673             CDS       T01002                                 

Gene name
Krt36, HRa, HRa-1, K36, Krt1-, Krt1-2, Krt1-22, Krt1-5, MHRa-1
Definition
(RefSeq) keratin 36
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16673 (Krt36)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16673 (Krt36)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16673 (Krt36)
   04147 Exosome [BR:mmu04147]
    16673 (Krt36)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16673 (Krt36)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16673 (Krt36)
  Exosomal proteins of other body fluids (saliva and urine)
   16673 (Krt36)
  Exosomal proteins of colorectal cancer cells
   16673 (Krt36)
  Exosomal proteins of melanoma cells
   16673 (Krt36)
SSDB
Motif
Pfam: Filament Lzipper-MIP1 TPR_MLP1_2 Baculo_PEP_C
Other DBs
NCBI-GeneID: 16673
NCBI-ProteinID: NP_001167570
MGI: 109364
Ensembl: ENSMUSG00000020916
Vega: OTTMUSG00000002549
UniProt: B1AQ75
Position
11; 11 D
AA seq 473 aa
MATQICTPTFSAGSAKGLCGTSGSFSRISSIHSMGSCRAPSLVGTVGSVSSFRTGFSGPG
SCLPGSYLSSGCHSSGFAGSGGWFCEGAFNGNEKATMQILNDRLANYLEKVRQLEQENTQ
LECRIREWYECQIPYICPDYQSYFKTAEELQQKILLTKSENARLILQIDNAKLAADDFRT
KYETELSLRQLVEADINGLRRILDELTLCKADLEAQVESLKEELLCLKRNHEEEVNALRS
QLGDRLNVEVDAAPPVDLNKILDDMRCQYETLVENNRRDVEAWFNTQTEELNQQVVSSSE
QLQCCQTEIIELRRTVNSLEIELQAQQSMRNSLESTLAETEARYSSQLGQMQCLITNVES
QLAEIRCDLERQNHEYQVLLDVKARLESEIATYRRLLDGEDCKLPAHPCSTECKPAVRVP
YIPSTTCTPAGPCTPAGPCTPAPQVSTQIRTITEEIRDGRVISSREHVVPRAM
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggccacccagatctgcaccccgaccttctctgctgggtctgccaagggcctctgtggc
acttcagggagcttctctcggatatcttccatccattccatgggctcctgcagggccccc
agtttggttggcactgtggggtccgtgtcctccttcaggacaggcttctctggccctggg
agctgcttgccaggctcctacctgtcctctgggtgccactcctctggctttgctgggagc
gggggatggttctgcgagggcgccttcaatggcaacgagaaggcgaccatgcagatcttg
aatgaccgactggccaactacctggagaaggtgcggcagctggagcaggagaacacacag
ctggagtgccgcatccgagagtggtacgagtgtcagatcccatacatctgcccggactac
cagtcctacttcaagactgctgaggagttgcagcagaagatcctgctgaccaagtctgag
aatgccaggctgatattacaaattgacaatgccaagctggctgctgatgacttccggacc
aagtatgagacggagttgtccctgcgacagctggtagaggctgacatcaatggtctacgc
cggatcttggatgagctgaccttgtgtaaggctgacctggaggcacaggttgagtccctg
aaggaggagctgctgtgtctcaagaggaaccatgaagaggaagtcaatgccctccgttcc
cagcttggggaccgactgaatgtggaggtggatgctgctcccccagtggatctcaacaag
atactggatgacatgcgatgccagtatgagacgctggtggagaataaccgtagagatgtg
gaggcttggttcaacactcagaccgaggagctgaaccagcaggtggtatccagctcagag
cagctgcagtgttgccagacagagatcattgagctgagacgcacagtcaactccctggag
atcgagctgcaggctcaacagagcatgaggaattctctggaatctaccctggctgagaca
gaggcccgctacagctcccagctgggccagatgcagtgcctgatcaccaacgtggaatcc
cagctggctgagattcgttgtgacctggagcggcagaaccatgagtatcaggtgttactg
gatgtcaaggcccggctggagtcagagattgccacctaccgtcgcctgctggatggggag
gactgcaagcttcctgcccacccttgttccacggaatgcaagcctgctgtaagagtacct
tatatcccttctacaacctgcactccagctgggccctgcaccccagctgggccctgcacc
ccagctcctcaagtcagcacccagatccggaccatcaccgaggagatcagggatggaaga
gtcatctcctccagggagcacgtggtgccccgggcaatgtga

KEGG   Mus musculus (mouse): 16675
Entry
16675             CDS       T01002                                 

Gene name
Krt27, CK-27, Krt1-c2, Krt1-c29, mIRS, mIRSa3.1, st, stpm
Definition
(RefSeq) keratin 27
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16675 (Krt27)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16675 (Krt27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16675 (Krt27)
   04147 Exosome [BR:mmu04147]
    16675 (Krt27)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16675 (Krt27)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16675 (Krt27)
  Exosomal proteins of other body fluids (saliva and urine)
   16675 (Krt27)
  Exosomal proteins of colorectal cancer cells
   16675 (Krt27)
  Exosomal proteins of melanoma cells
   16675 (Krt27)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 ATG16 Bacillus_HBL DUF2312
Other DBs
NCBI-GeneID: 16675
NCBI-ProteinID: NP_034796
MGI: 1339999
Ensembl: ENSMUSG00000017588
Vega: OTTMUSG00000006439
UniProt: Q9Z320
Position
11 D; 11 62.92 cM
AA seq 448 aa
MSVRFSSASRRLGSVRLSSAGAALGAGNACGVPGIGSGFSCAFGGSSLAGGLGMGGASCG
AFTANEHGLLSGNEKVTMQNLNDRLASYLENVQALEEANADLEQKIKDWYEKFGPGSCRG
LDHDYSRYFPIIDDLRTQIISATAHNANIILQNDNARLTADDFRMKYENELALHQSVDAD
INGLRRVLDELTLCRTDLEVQLETLSEELAYLKKNHEEEMQALQCAAGGNVNVEMNAAPG
VDLTVLLNNMRAEYEALAEQNRRDAEAWFQEKSASLQQQISDDAGATTSARNELTEMKRT
LQTLEIELQSLLAMKHSLECSLTETEGNYCTQLAQIQAQISALEEQLHQVRTETEGQKLE
YEQLLNVKAHLEKEIETYCRLIDGDEGSCVKAKGQGRPGNQTKDSPKTAIVKTVVEELDP
RGKVLSSRVHTLEEKSTKVNKTEQRIPS
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtccgttcgcttttcttccgcatccagacggctgggctctgtgaggctctccagcgcg
ggagcagccttgggggctggaaacgcatgcggagtgccgggcatcggaagcggcttctcc
tgcgcctttgggggcagttcattggcaggggggctcggtatgggcggtgcttcttgtggg
gccttcacagcgaatgagcacggcctcctctccggcaatgagaaggtcaccatgcagaac
cttaatgaccgcctggcctcctacctggagaacgtgcaagcactggaggaggccaatgct
gacctggagcagaagatcaaggactggtatgaaaaatttggacctgggtcgtgccgcggt
ctcgatcatgactacagtagatacttccccatcattgatgacctcaggacccagatcatc
tctgcaactgcacacaacgccaacatcatcctgcaaaatgacaacgcaagactgacggcg
gatgacttcagaatgaagtatgagaatgaactggcactccaccagagcgtcgatgctgac
atcaatggcttgcggagggtcctggatgagctgaccctgtgcagaaccgaccttgaggtc
cagctggaaacactcagtgaggagctggcatacctcaagaagaaccacgaggaggaaatg
caggctctgcagtgcgccgctggaggcaacgtgaacgtggagatgaacgcagccccgggc
gtggacctcaccgtcctgctgaacaacatgagagccgagtacgaggccctggctgagcag
aaccgtagggacgccgaggcctggttccaagagaagagcgcctccctgcagcagcagatt
tcagacgatgctggagccaccacctcagccaggaacgaacttacagagatgaaacggact
ctccaaaccctggagatagagctacagtccctcttagccatgaaacactctctggagtgc
tccctgacggagaccgagggcaactactgcacgcagctggctcagatccaggctcagatc
agcgccctggaggagcagctgcaccaagtgaggacggagacggagggccagaagctggaa
tatgagcagctgctgaatgtcaaggcccacctggagaaggagatcgagacctactgccgc
ctcatagatggagacgagggctcttgtgttaaggcaaaaggccaaggaagacccggaaat
cagacaaaagattcgcctaaaactgccatcgttaaaactgtcgtggaagagttagacccc
cgtggcaaggttctctcctccagagttcacaccctggaagagaaatccaccaaagtcaac
aagaccgagcagaggatcccttcttga

KEGG   Mus musculus (mouse): 237934
Entry
237934            CDS       T01002                                 

Gene name
Krt39, 4732494G06Rik, Ka35
Definition
(RefSeq) keratin 39
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    237934 (Krt39)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    237934 (Krt39)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    237934 (Krt39)
   04147 Exosome [BR:mmu04147]
    237934 (Krt39)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     237934 (Krt39)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   237934 (Krt39)
  Exosomal proteins of other body fluids (saliva and urine)
   237934 (Krt39)
  Exosomal proteins of colorectal cancer cells
   237934 (Krt39)
  Exosomal proteins of melanoma cells
   237934 (Krt39)
SSDB
Motif
Pfam: Filament DMPK_coil
Other DBs
NCBI-GeneID: 237934
NCBI-ProteinID: NP_998895
MGI: 3588208
Ensembl: ENSMUSG00000064165
Vega: OTTMUSG00000004991
UniProt: Q6IFX4
Position
11; 11 D
AA seq 482 aa
MDTKGSTVTISSSTPPQNCSGNTNFRTNSSSNKSCCHDGQSTGCALQTPQGQGCGSSPCL
YRCPHYLIRTYSFHPCLDDGSRCTEGINTHEKETMQILNERLANYLEKVRMLEGENADLE
DKIQEACSKALPILCPDYLSYYTTIEELQQKILCTKAENSRLVSQIDNTKLAADDLRANY
EAELSLRQLVEADANGLKQILDALTLSKADLEARVQSLTEELLCLKTNHEEEVNSLQCQL
GDRINIEVTAAPSVDLNQILQEMRCRYESIMETNRKDVEEWFNTQMEELNQQVVSSSQQQ
QCCQKDIIELRRTISALEIELQAQHRMRESQECILTETEARYTALLAQIQSLIHNLEAQV
ADIRSALQRQSQEYEVLLDIKSRLECEIATYRSLLESLDGRLPCNPCATKWEPSCQARAM
ECFTPVYTSSSLPGIHKPCRASGPPSRILVKICTITKEIKDGKVISSYEHVQPCYITRAT
KV
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggataccaagggctctacagtgacgatttcttcttcaaccccaccccaaaactgctct
gggaatacaaattttaggacgaactcttcttctaacaagagctgttgtcatgatggccag
tcaactggctgtgctctacaaactccccagggccagggctgtggatccagcccttgcctt
tatcgatgccctcattacttgataagaacctacagcttccatccttgtctggatgatggc
agcaggtgcactgaaggcattaacactcatgagaaggagaccatgcagattttgaacgaa
cgccttgcaaactatctggaaaaggtgcggatgctggaaggagagaacgcggacctagag
gataaaatccaggaggcatgcagcaaggcgctccccatcctgtgtcctgactacctgtcc
tactacaccaccatcgaggagctgcagcagaagatcttgtgtaccaaggctgaaaattcc
agactggtctcacaaattgacaacaccaaactggctgcagatgacttgagagccaactat
gaagctgagttgtccctgcgccagcttgtggaagccgatgccaatggcctgaagcagatc
ctggatgcactcactctgagcaaggctgacctggaggcccgagtccagtctctgacggag
gaacttctgtgcctcaaaacgaaccatgaggaagaagttaattccttacagtgccaacta
ggggacagaatcaacattgaagtaacagctgccccttctgttgacctaaatcaaatccta
caagaaatgagatgccggtacgagtccatcatggagacaaaccgtaaagacgtagaagaa
tggttcaatacacagatggaggaactgaatcaacaagtagtgagcagctctcagcagcag
caatgctgccagaaggacatcatagagctgagacggaccataagtgccctcgagattgag
ctgcaggcccagcacagaatgagagagtcccaggaatgcatcctgacggagacggaggcc
cgctacacagccctgctggcccaaatccagagtctgatccacaacctggaggctcaggtg
gcagatatccgcagtgccctgcaaagacagagccaggaatatgaagttctgctagacatc
aagtcccggctggagtgtgagatagccacataccgaagccttcttgagagcttagatggc
aggcttccctgtaacccatgtgccactaagtgggagccatcctgccaggccagagctatg
gagtgttttaccccagtttatacatcttcatcactccctgggattcacaagccctgccgt
gcctctggacccccatcccggatacttgttaagatatgcaccatcaccaaggagatcaag
gatgggaaggtcatttcttcttacgagcatgtgcagccttgctacatcaccagagctacc
aaagtctag

KEGG   Mus musculus (mouse): 268482
Entry
268482            CDS       T01002                                 

Gene name
Krt12, AI835216, K12, Krt-12, Krt1-1, Krt1-12
Definition
(RefSeq) keratin 12
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    268482 (Krt12)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    268482 (Krt12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    268482 (Krt12)
   04147 Exosome [BR:mmu04147]
    268482 (Krt12)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     268482 (Krt12)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   268482 (Krt12)
  Exosomal proteins of other body fluids (saliva and urine)
   268482 (Krt12)
  Exosomal proteins of colorectal cancer cells
   268482 (Krt12)
  Exosomal proteins of melanoma cells
   268482 (Krt12)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 APC_N_CC DUF4407
Other DBs
NCBI-GeneID: 268482
NCBI-ProteinID: NP_034791
MGI: 96687
Ensembl: ENSMUSG00000020912
Vega: OTTMUSG00000004989
UniProt: Z4YJD9
Position
11 D; 11 62.92 cM
AA seq 487 aa
MSLSVCTSALSRRSSSQNGAAGRPWGASASSVAGGYGGSASGFGVGCGGLFSAASMFGSS
SGFSGGSAGCLPGLGSAYGGPLRGGAGGMGIGMGIAGSSGGGSLCIFSGNDGGLLSGSEK
ETMQNLNDRLASYLGKVRSLEEANAELENKIREWYETRRTRDAGSQSDYSKYYPLIEDLK
NKIVSARVSNAQLLLQIDNARLAAEDFRMKYENELALRQTVEADINGLRRVLDELTLTRA
DLEAQLETLTEELAYMKKNHEEELQSFQAGGPGEVNVEMDAAPGVDLTKVLNEMRAQYEA
MAEQNRKDAEAWFLEKSRELRKEISSNTEQLQSSKSEVTDLKRMVQNLEIELQSQLAMKS
SLEGSLAETEGGYCCQLSQVQQLIGSLEEQLQQVRADAERQNADHQRLLGVKARLEMEIE
TYRRLLEGDSQGDGFDESSSLSVSKPQTPSVDSSKDPNKTRKIKTVVQEIVNGEVVSSQV
QELEEEM
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgtcgctttcagtctgcacctctgcgctgtccaggaggtcttcctcacagaatggggcg
gcaggcagaccttggggtgcatctgcttctagtgttgccggcggctatgggggatcggcc
tctggctttggagttggctgtggaggcctcttttctgctgcttccatgtttggttctagt
tctggctttagcggtggctctgcaggttgcttgccggggcttggctctgcctatggggga
cctctgagaggtggcgcgggaggaatggggatagggatggggatagctggaagctcgggc
ggtggctctctgtgtatcttttctggcaatgatggaggtcttctttctggttctgagaaa
gaaaccatgcaaaatctaaatgacagactagcttcctacctgggtaaggttcgctctcta
gaggaggctaatgcagaactggaaaacaaaattcgagagtggtatgaaacacggagaacc
agagacgctgggtctcagagtgattacagtaaatactacccactgattgaagacttgaag
aataagatcgtttctgccagagtcagcaacgcccagctcctcctgcagattgacaacgca
aggctggctgccgaggacttcaggatgaagtatgagaatgagctggccctgcgccagacc
gtggaggccgacatcaacgggctgcgaagggtgctggacgagctgaccctgactagagcc
gacctggaagcccagcttgagaccctcactgaggagctggcttacatgaagaagaaccac
gaagaggaactccaaagtttccaggcaggtggtccaggtgaggtcaatgtagaaatggac
gcggcccctggagtggatctcaccaaggtcctcaatgaaatgagagcccagtatgaagcc
atggctgagcaaaatcggaaagatgcagaggcctggtttcttgaaaagagcagagagctc
cgaaaagagatcagcagcaacacggagcagcttcagtccagcaagagcgaggtcaccgac
ctgaagcgcatggtgcagaacctagagattgaactccagtcccagctcgccatgaagtcg
tccctggaaggctcgctggctgaaaccgagggtgggtactgctgccaactgtctcaggtg
cagcagctgatcggcagcctggaggagcaactccaacaggtgcgggctgacgcggagcgc
cagaatgcggaccaccagcggctgctgggcgtcaaggctcgcctggagatggagattgag
acctaccgccggctgctggagggggacagccaaggcgacggttttgacgagagctcatcc
ctttctgtctccaaaccgcagacaccatcagtcgattcctctaaagacccaaataaaact
cgaaaaatcaagacagtcgtgcaggagatagtgaatggcgaagtggtctcatcccaggtt
caggaacttgaagaagagatgtaa

KEGG   Mus musculus (mouse): 320864
Entry
320864            CDS       T01002                                 

Gene name
Krt26, 4732407F15Rik, Krt25b
Definition
(RefSeq) keratin 26
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    320864 (Krt26)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    320864 (Krt26)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    320864 (Krt26)
   04147 Exosome [BR:mmu04147]
    320864 (Krt26)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     320864 (Krt26)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   320864 (Krt26)
  Exosomal proteins of other body fluids (saliva and urine)
   320864 (Krt26)
  Exosomal proteins of colorectal cancer cells
   320864 (Krt26)
  Exosomal proteins of melanoma cells
   320864 (Krt26)
SSDB
Motif
Pfam: Filament DUF5703_N TPR_MLP1_2 APG6_N
Other DBs
NCBI-GeneID: 320864
NCBI-ProteinID: NP_001028569
MGI: 2444913
Ensembl: ENSMUSG00000075570
Vega: OTTMUSG00000006449
UniProt: Q3TRJ4
Position
11; 11 D
AA seq 462 aa
MSFRFSGRSRVCSRAGSVRLSRGGAGFVAGNVCVGPGAEGSFSCTLGGLSSGGSFASEGS
GRGSSIGFLNNEPGLFSGNEKVAMQNLNDRLALYLNHVSALEEANTDLEKKIEGWYEKCG
PGRGRRLDHDCSRYFSVIEDLKRQILSMTTCNANLVLQNDNARLTADDFKMKYENELALH
QSVEADTNGLRRVLDELTLSTTDLEIQREALSEELTYLQKNHEEEMVVLQNASGGNINVE
MNAAPSVDLTAMLNNMRAEYEDLAEQNRKDAEASFKEKSASLQQQISDDAGAATAARNEL
MELKRNLQTLEIELQSITAMKQSYENSLAETEGNYYAQLQQIQEQIGAREEQLQQIRTET
EGQKLEHEQLLGIKTCLEKEIDTYCNLLDGEEQRSESTSYKPKDGKPASEFNDSAEETFA
RTVAEELDQLGNLLSLRVHSVEEKSSKISNITMEQRVPSKAP
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtcttttcggttttcggggcgatccagggtctgttctcgagctgggtctgtcaggctg
tccagaggaggggcaggctttgtggccgggaacgtgtgtgttgggcctggagcggaaggc
agcttttcttgcacccttgggggcctctcttctggaggaagctttgccagcgaggggtca
ggtaggggaagtagcattggcttccttaacaacgagccaggactcttctctgggaacgag
aaggtggccatgcagaacctcaatgaccgcctggccttgtacctgaaccacgtgagtgcc
ctggaggaggccaacacggacctggagaagaagatcgagggctggtacgagaagtgtggg
cccggcagaggccgtagacttgaccatgactgcagccggtatttctcagtcattgaggat
ttgaaacgacagatcctgtctatgaccacctgcaatgccaaccttgtccttcaaaatgac
aatgccagactcacagctgatgacttcaagatgaagtatgaaaatgaactggctctgcac
cagagtgttgaggctgacaccaacggccttcgcagagtgttggacgagctgacgctgtct
acaaccgacttggaaatacaacgggaggctctgagcgaggagctgacgtacctccaaaag
aaccacgaggaggaaatggtggttctgcaaaatgcatcaggggggaacatcaatgtggag
atgaacgcagcccccagcgtggatctaaccgccatgttgaacaacatgagggccgaatat
gaagatttggctgagcagaaccggaaagatgcagaggccagctttaaagagaagagcgcg
tcgctgcagcaacagatttcagatgacgcaggagcagccacagcagccagaaacgaactg
atggaactgaaacgcaatctgcagactctagagatagaacttcagtccatcacggctatg
aaacaatcctacgaaaattcattggctgagaccgaagggaattactatgctcaactccag
caaattcaggagcagattggggcgcgggaggagcagctgcagcagatccgaacagagacg
gaaggccagaagctggagcacgagcagctgctgggcatcaaaacgtgtttagagaaggag
attgacacatactgcaacttactagacggagaggaacaaagaagtgaatccacaagttac
aaaccaaaggatggcaagcctgcaagtgaattcaatgactcagcagaagaaacatttgcc
agaacagtggctgaagagctagatcaacttggtaacctcctttcactgagagtgcactcc
gtggaagaaaaatcctctaagatcagcaatatcaccatggagcagcgggtgccttccaaa
gccccatag

KEGG   Mus musculus (mouse): 406221
Entry
406221            CDS       T01002                                 

Gene name
Krt40, CK-40, K40, Ka3
Definition
(RefSeq) keratin 40
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    406221 (Krt40)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    406221 (Krt40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    406221 (Krt40)
   04147 Exosome [BR:mmu04147]
    406221 (Krt40)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     406221 (Krt40)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   406221 (Krt40)
  Exosomal proteins of other body fluids (saliva and urine)
   406221 (Krt40)
  Exosomal proteins of colorectal cancer cells
   406221 (Krt40)
  Exosomal proteins of melanoma cells
   406221 (Krt40)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 TcpS UPF0242 Phage_GP20 UFD1 FliD_C Not3
Other DBs
NCBI-GeneID: 406221
NCBI-ProteinID: NP_001034755
MGI: 3629968
Ensembl: ENSMUSG00000059169
Vega: OTTMUSG00000004986
UniProt: Q6IFX3
Position
11 D; 11
AA seq 439 aa
MASDGSPSCCSSEPCAGASGCATASFCPTNTTCLPNTCSTSRCQTPSFLCRASLPACCLS
PCYLAGGCNSPCLVGSCAWCEEGSFNSNEKETMQFLNDRLASYLERVRSLEENNAELECR
IREQCEPNAPLVCPDYQRYFDTIEELQQKILCTKAENSRLAVQVDNCKLAADDFRSKYES
ELSLRQLVENDITGLRGILGELTLCKSDLEAHVESMKDDLICLKKGHEEEVNLLREQLGD
RLSVELDTAPTVDLNKVLDEMRCQYERVLANNRRDAEEWFAAQTEELNQQQKSSAEQLEG
CQTEMLELKRKANTLEIELQAQQTLTESLECTVAETEAQYSTQLAQMQCLIDSVEHQLAE
IRCDLERQNQEYQVLLDTKARLECEINTYRGLLEKEDSRLPCNPGSGAPMPNSTCEPCSN
SMCEPCSAYVICTVENCCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggcttccgatggctcccctagctgctgctcttctgagccctgtgcaggggcttccggc
tgcgcaactgcctcattctgccccaccaacacaacttgcctccccaacacctgttccaca
tccagatgtcaaaccccaagcttcctctgcagggcttccctcccagcctgttgcctctca
ccgtgctacttggctggtggctgtaacagtccttgcctggtggggagctgtgcatggtgt
gaggaaggatcgttcaacagtaatgagaaggagaccatgcagttcctgaatgaccgcctg
gccagctatctggagagggtgagaagcctggaagagaacaacgcagagctggagtgcagg
atccgagagcaatgcgagcccaatgcccctctggtctgccccgattatcagcggtacttc
gacaccattgaagaactccaacaaaagatattgtgcacaaaggcagagaattctagactt
gccgttcaggtggacaactgcaaactggctgctgatgatttcaggtcaaaatatgagagc
gaactgtccctgcgccagctggtggagaacgacatcactggccttcgtgggatcctgggt
gaactgaccctgtgcaagtcagatctagaggcccacgtggagtctatgaaagatgatctg
atttgccttaagaaaggccatgaagaggaggtcaacctgcttcgtgagcagcttggcgat
cggctcagcgtggagctggacactgcccccactgtggacctcaacaaggtcctggatgag
atgcgatgtcaatacgagagggtgctggccaacaaccgcagggatgcagaggagtggttc
gctgctcagacagaagagctgaaccagcagcagaagtccagcgcggagcagttggagggc
tgccagactgagatgttggagttgaagcgcaaggccaacactctggaaattgagctccag
gcgcagcaaaccctgacggagtctctggagtgtactgtggcagaaaccgaggcccagtac
agcacacaactggcccaaatgcagtgcctaattgacagtgtggagcaccagctggctgag
atccgctgtgacctggagcgtcagaaccaggagtaccaggtgctgctggacaccaaggcc
cggctggagtgtgagatcaacacgtacaggggcctgctggagaaggaggacagcagactc
ccctgcaatccaggctccggagcacccatgccgaacagcacatgtgagccgtgttcaaac
agcatgtgtgagccgtgttcagcctatgtgatttgcacagttgaaaactgctgtgcatga

KEGG   Mus musculus (mouse): 53617
Entry
53617             CDS       T01002                                 

Gene name
Krt35, AI662400, Ha, Ha5, Krt1-2, Krt1-24, Krtha5
Definition
(RefSeq) keratin 35
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    53617 (Krt35)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    53617 (Krt35)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    53617 (Krt35)
   04147 Exosome [BR:mmu04147]
    53617 (Krt35)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     53617 (Krt35)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   53617 (Krt35)
  Exosomal proteins of other body fluids (saliva and urine)
   53617 (Krt35)
  Exosomal proteins of colorectal cancer cells
   53617 (Krt35)
  Exosomal proteins of melanoma cells
   53617 (Krt35)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 DivIC DUF5082 DUF2551 Lzipper-MIP1 SKA1 FapA
Other DBs
NCBI-GeneID: 53617
NCBI-ProteinID: NP_058576
MGI: 1858899
Ensembl: ENSMUSG00000048013
Vega: OTTMUSG00000002218
UniProt: Q497I4
Position
11; 11 D
AA seq 455 aa
MASKCLKASFSSGSLKSPGKAGGGSTRVSNMYSSSSCKLPSPSRGARSFSVCSAGLGRGN
YRVSSCLPALCLPTGGFATSYGTGGGWFGEGILTGNEKETMQSLNDRLASYLEKVRQLEQ
ENASLESRIREWCEQQVPYMCPDYQSYFRTMEELQKKTLCSKAENARLVVQIDNAKLAAD
DFRTKYETEVSLRQLVEADINGLRRILDDLTLCKADLEAQVESLKEELLCLKKNHEEEVN
SLRCQLGDRLNVEVDAAPPVDLNRVLDEMRCQYETLVENNRRDAEDWYDTQTEELNQQVV
SSSEQLQSCQSDIIELRRTVNSLEIELQAQQSMRDALDSTLAETEGRYSSQLAQMQCMIG
NVESQLGEIRADLERQNQEYQVLLDVRARLECEINTYRGLLESEDSKLPCNPCAPDYSSS
KSCLPCLPAVSCSTGAARTTCSPRPVCVPCPGGRF
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggcttccaaatgcctcaaggccagcttctcctcaggatctctgaagagcccggggaaa
gccggagggggatccactcgcgtgtccaacatgtactccagcagctcttgcaagctgccc
agcccttcccgtggagcccggagtttctccgtgtgttccgctggcctggggagaggcaat
tacagggtatccagctgcctcccagctctctgcctcccaacgggaggctttgccaccagc
tacggcacgggtggaggttggtttggagaaggcatcctcactggtaatgagaaggagacc
atgcagtccctgaatgaccgcctggccagctatctggagaaggtgcgccagctggagcag
gagaatgccagcctggagagccgaattcgggagtggtgtgagcagcaggtgccctatatg
tgccccgattaccagtcttacttccggaccatggaggagctccagaagaagactctttgc
agcaaggcagagaacgccaggctggtggtgcagattgacaatgccaagctggctgctgat
gacttcaggaccaagtatgagactgaggtttccctgcggcagctggtggaggctgacatc
aatggcctgcgcagaatcctggatgatctgactctgtgcaaggctgacctggaagctcag
gtggagtctctgaaggaagaattgctttgcctcaagaagaaccatgaggaggaagtgaac
tcactgcgctgccagcttggcgatcggctcaatgttgaggtggatgctgctccacccgtt
gacctgaaccgcgttctggatgagatgaggtgccagtatgagaccttggtggagaataac
cggagggatgctgaagactggtatgacacccagaccgaggaactgaaccagcaggttgtg
tccagctcagagcagctgcagtcctgccagtcggacatcattgagttgagacgcactgtc
aactctctggagatagagctgcaggcccagcagagcatgagagatgctttggactccacc
ctggcagagacagaaggccgctacagctctcagctggctcagatgcagtgcatgatcggc
aatgtggagtcccagcttggtgagatccgggctgacctggagcgtcagaaccaggagtac
caggtgctgctggatgtccgggccaggctggagtgtgagatcaacacgtacaggggcctg
ctggagagcgaggacagcaagcttccctgcaacccgtgtgcccctgactactcttcctcc
aagtcatgcctcccctgccttcctgcggtctcctgcagcacgggcgcagctcgtaccacc
tgcagcccccgccctgtctgtgtgccctgcccagggggccggttctga

KEGG   Mus musculus (mouse): 66809
Entry
66809             CDS       T01002                                 

Gene name
Krt20, 9030623C06Rik, Ck-20, Ck20, K20, Krt21
Definition
(RefSeq) keratin 20
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    66809 (Krt20)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    66809 (Krt20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    66809 (Krt20)
   04147 Exosome [BR:mmu04147]
    66809 (Krt20)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     66809 (Krt20)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   66809 (Krt20)
  Exosomal proteins of other body fluids (saliva and urine)
   66809 (Krt20)
  Exosomal proteins of colorectal cancer cells
   66809 (Krt20)
  Exosomal proteins of melanoma cells
   66809 (Krt20)
SSDB
Motif
Pfam: Filament DivIC DUF1664
Other DBs
NCBI-GeneID: 66809
NCBI-ProteinID: NP_075745
MGI: 1914059
Ensembl: ENSMUSG00000035775
Vega: OTTMUSG00000004985
UniProt: Q9D312
Position
11; 11 D
AA seq 431 aa
MDFSRQSFHRSLSSSSQGPALSMSGSLYRKGTVQRLGAAPSVYGGAGGHGTRISVSKAVM
SYGGDLSNGSDLFGGNGKLAMQNLNDRLANYLEKVRSLEQSNSRLEAQIKQWYETNAPST
IRDYSSYYAQIKELQNQVKDAQVQNAQCVLRIDNAKLAAEDFRLKFETERGMRIAVEADL
QGLSKVYDNLTLQKTDLEIQIEELNKDLALLKKEHQEEVEVLRRQLGNNVNVEVDAAPGL
NLGEIMNEMRQRYEVLAQKNLQEAKEQFERQSQTLQQQVTVNTEELKGFEVQVTELRRTY
QNLEIELQSHLSMKESLERNLEDVKARYASQLAAIQEMLSSLEAQLMQIRSDTERQNQEH
NILLDIKTRLEQEIATYRRLLEGEDIKTTEYQLSTLEMKDIKKTRKIKTVVEEVVDGKVV
SSEVKEIEESV
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggatttcagtcgtcaaagttttcaccgaagtctgagttcctcctcacaaggcccagca
ctcagcatgagtggctcgctgtataggaaggggactgtgcagcgtctgggggctgcaccc
agcgtctatggtggggctggaggccatggcactcgcatctctgtctccaaagccgtaatg
agctacgggggtgatctctccaacggatcggacctgtttgggggcaatgggaaactggca
atgcagaacctgaacgacagattggcaaactacctagaaaaagtgcgctccctggagcaa
tccaattccagacttgaagcccagatcaagcagtggtacgaaaccaacgcgccgagcacc
atccgagactatagctcctactacgcacagattaaagagctgcaaaatcaggttaaggat
gctcaagtacaaaatgcccagtgcgtcctgcgaattgacaatgctaagctggctgcagag
gacttcagattgaagtttgagactgagaggggaatgcgtatagctgtggaagctgatctc
caaggcctgagcaaagtttatgataatctgactcttcaaaagacagacttggaaattcag
attgaagaactgaacaaggacctggccctcctcaaaaaggaacatcaagaggaagttgag
gttcttcgccggcagctgggcaacaatgtcaacgtggaggtggatgctgctccaggcctg
aacctgggagagatcatgaatgagatgagacagagatatgaagtcctggcccagaagaac
ctgcaagaggccaaagaacagttcgagagacagagtcaaactctgcagcaacaagtcaca
gtgaacacggaggagctgaaaggattcgaggttcaagtcacggagctgagacgcacctac
cagaacctggagatagagttgcagtcccacctcagcatgaaagagtctctggagcgcaac
ctagaggacgtcaaggctcgttacgccagccagttggcagccatccaggagatgctgagc
tccctggaggcccaactgatgcagatcaggagtgacacagaacgccagaaccaagaacac
aacatccttctcgacataaagacccggcttgagcaggagatcgccacctaccgccgcctt
ctggagggagaagatataaaaactacagaataccagctgagcactttggaaatgaaggat
atcaagaaaaccaggaagattaagacggtcgtggaagaagtggtagacggcaaggtcgtg
tcctctgaagtcaaggagatagaagagagtgtctaa

KEGG   Mus musculus (mouse): 68239
Entry
68239             CDS       T01002                                 

Gene name
Krt42, 2410039E07Rik, CK-42, K17, K17n, K42, Ka2, Ka22, ecat, ecat6
Definition
(RefSeq) keratin 42
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    68239 (Krt42)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    68239 (Krt42)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    68239 (Krt42)
   04147 Exosome [BR:mmu04147]
    68239 (Krt42)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     68239 (Krt42)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   68239 (Krt42)
  Exosomal proteins of other body fluids (saliva and urine)
   68239 (Krt42)
  Exosomal proteins of colorectal cancer cells
   68239 (Krt42)
  Exosomal proteins of melanoma cells
   68239 (Krt42)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Bacillus_HBL DUF1664 RasGAP_C
Other DBs
NCBI-GeneID: 68239
NCBI-ProteinID: NP_997648
MGI: 1915489
Ensembl: ENSMUSG00000053654
Vega: OTTMUSG00000002542
UniProt: Q6IFX2
Position
11; 11 D
AA seq 452 aa
MASTTSVRQFSTSGSVKGLCAPGMGFSRMSSVRVGGACRAPSLLGGGSCGNMSVTSSRFS
AGLGGGYGGGYTCSLGGGFGSSFGVSDALLGGSEKETMQNLNDRLATYLDRVRALEEANA
DLEVKIREWYKKQGPGPARDYSPYFKTIEDLRNKILAATIDNASIVLQIDNARLAADDFR
TKYETELNLRMSVEADINGLRRVLDELTLARADLEMQIESLKEELAYLRKNHEEEMNALR
GQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNT
EALQSSRTEITELRRSVQNLEIELQSQLSMKASLENSLAETEARYGAQLAQLQGLISSVE
QQLCELRCDMERQNHEYQVLLDVKTRLEQEIATYRRLLEGEDAHLATQYSSSLASQPSRE
GMVTSRQVRTIVEEVQDGKVVSSREQVHRSTH
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggcttccactaccagtgtccgccagttttcaacttctggctccgttaagggcctttgt
gctcccggcatgggattctcccggatgtcctctgttcgtgttgggggtgcctgccgggct
cccagcctcttgggaggtggaagctgtggcaatatgtccgtcacctcctcccgcttctca
gcaggcttaggaggcggctatggtggtggctacacttgcagcctgggtgggggctttggc
tccagttttggtgtgtcggatgccctcctagggggcagtgagaaggagaccatgcagaat
cttaatgaccggctggccacctacttagacagggtgcgtgccctggaggaggccaacgct
gacctggaggtgaagatccgtgagtggtacaagaagcagggccccggaccggctcgtgac
tacagcccctacttcaagaccatagaggacctgcggaacaagatcctggcagccacaatc
gacaacgccagcatcgtgctgcagattgacaacgctcgcctggcagccgatgacttccgc
accaagtacgagacagagctgaacctgcgcatgagcgtggaggccgacatcaatggcctg
cgccgggtgctggatgaactgaccctggccagagccgacctggaaatgcagatcgagagc
ctgaaggaggagctggcctatctgaggaagaaccatgaggaggaaatgaatgcccttcgt
ggccaggtgggcggggacgtcaatgtggagatggacgccgcccccggtgtggacctgagc
cgcatcctgaacgagatgcgggatcagtatgagaagatggcggagaagaaccgcaaggat
gctgaggaatggttcttcaccaagacagaggagctgaaccgagaagtggccaccaacacg
gaggccctgcagagcagccggacagagatcacggagctccgccgctctgtgcagaacctg
gagattgagctgcagtcccagctcagcatgaaagcatcactggagaacagcctggcagag
acagaggcgcgctatggggcccagctggcgcagctgcagggcctcattagcagtgtggaa
cagcagctgtgtgagctgcgttgtgacatggaaaggcagaatcatgagtaccaggtgctg
ctggatgtgaagacccgactggagcaggagatcgccacctaccgccgtctgctggagggc
gaggacgcccacctggctactcaatactcctcatccctggcttcgcagccctcccgagaa
ggcatggtgaccagccgccaggtgcgcaccattgtggaggaagtccaggatggtaaggtg
gtctcctccagagagcaggtgcaccgctccacccactga

KEGG   Mus musculus (mouse): 70810
Entry
70810             CDS       T01002                                 

Gene name
Krt25, 4631426H08Rik, CK-25, K25, Ka38, Krt25a, mI, mIRSa1
Definition
(RefSeq) keratin 25
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    70810 (Krt25)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    70810 (Krt25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    70810 (Krt25)
   04147 Exosome [BR:mmu04147]
    70810 (Krt25)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     70810 (Krt25)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   70810 (Krt25)
  Exosomal proteins of other body fluids (saliva and urine)
   70810 (Krt25)
  Exosomal proteins of colorectal cancer cells
   70810 (Krt25)
  Exosomal proteins of melanoma cells
   70810 (Krt25)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Phage_Mu_Gam
Other DBs
NCBI-GeneID: 70810
NCBI-ProteinID: NP_598491
MGI: 1918060
Ensembl: ENSMUSG00000035831
Vega: OTTMUSG00000006453
UniProt: Q8VCW2
Position
11; 11 D
AA seq 446 aa
MSLRLSSGSRRSYARPSTGSLRGASFGAGNACGVAGIGSGFSCAFGGSSTGGNTGVANSC
AGFTVNEGGLLSGNEKVTMQNLNDRLASYLDNVQALQEANADLEQKIKGWYEKFGPGSCR
GLDHDYSRYFPIIDDLKNQIITSTTSNANAVLQIDNARLTADDFRLKYENELALHQSVEA
DVNGLRRVLDEITLCRTDLEIQYETLSEELTYLKKNHKEEMQALQCAAGGNVNVEMNAAP
GVDLTVLLNNMRAEYEALAEQNRRDAEAWFQEKSASLQQQITEDVGATTSARNELTEMKR
TLQTLEIELQSLLATKHSLECSLTETEGNYCTQLAQIQAQISALEEQLHQVRTETEGQKL
EYEQLLNVKAHLEKEIETYCLLIGGDEGACKSSSYKSKDYGSGNAGNQIKDPVKAIVVKK
VLEEVDQRSKILTTRLHSLEEKSQSN
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgtctcttcgcctttccagtggatccaggaggtcctatgctcgccccagcacagggtcg
ctcaggggagccagcttcggagctggaaatgcatgtggcgtggcaggcattggaagtggc
ttctcctgcgccttcgggggcagctccacaggaggaaacacgggggtggccaactcctgt
gctggcttcactgtgaatgagggggggctcctctccggcaatgagaaggtgaccatgcag
aaccttaatgaccgcctggcctcctacctggacaacgtgcaagcgctgcaggaggccaac
gctgacctggagcagaagatcaagggctggtatgaaaaatttggacctgggtcgtgccgc
ggtctcgatcatgactacagtagatacttccccatcattgatgatctaaaaaaccagatc
atcacctccaccaccagcaacgccaacgctgtactgcagattgacaatgccaggctcacg
gctgatgacttcagactcaagtacgaaaacgagctggctctccaccagagcgtagaggct
gacgtcaacgggctgcgcagagttctggatgaaatcaccctgtgccgcactgacctggag
attcagtacgaaaccctgagcgaggagctgacctatctcaagaagaaccacaaagaggaa
atgcaggctctgcagtgcgccgctggaggcaacgtgaacgtggagatgaacgcagccccg
ggcgtggacctcaccgtcctgctgaacaacatgagagctgagtatgaggccctggctgag
cagaaccgcagggacgctgaggcctggttccaagagaagagtgcttcgctgcagcagcag
atcaccgaggacgtgggtgccaccacctcagccaggaatgagctcaccgaaatgaagcga
acgctccaaaccctggagattgaactgcagtctctcctggccacgaaacactctctggag
tgctccctgacggagaccgagggcaactactgcacgcagctggctcagatccaggctcag
atcagcgccctggaggagcagctgcaccaggtgaggacggagaccgagggccagaagctg
gaatatgagcagctgctgaatgtcaaggcccacctggagaaggagatcgagacctactgc
ctcctcataggaggagatgaaggggcctgtaagtcttcgagttacaagtctaaagattat
ggatctggaaacgccggaaaccaaatcaaagatccagtcaaagccatagtggttaagaag
gttctagaggaggtggatcagcgcagcaagatactgaccactaggctccactccctggaa
gagaaatctcaaagcaattag

KEGG   Mus musculus (mouse): 70843
Entry
70843             CDS       T01002                                 

Gene name
Krt28, 4733401L19Rik, CK-28, K25D, K28, Krt25d
Definition
(RefSeq) keratin 28
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    70843 (Krt28)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    70843 (Krt28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    70843 (Krt28)
   04147 Exosome [BR:mmu04147]
    70843 (Krt28)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     70843 (Krt28)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   70843 (Krt28)
  Exosomal proteins of other body fluids (saliva and urine)
   70843 (Krt28)
  Exosomal proteins of colorectal cancer cells
   70843 (Krt28)
  Exosomal proteins of melanoma cells
   70843 (Krt28)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 FlxA FliJ Gp58 DUF5703_N Phage_Mu_Gam Lectin_N
Other DBs
NCBI-GeneID: 70843
NCBI-ProteinID: NP_081850
MGI: 1918093
Ensembl: ENSMUSG00000055937
Vega: OTTMUSG00000004971
UniProt: A6BLY7
Position
11; 11 D
AA seq 462 aa
MSLRFSGGSRHVGIQSGSLRPPSGGAGFAGSSVAGGSVAGSGFSWALGGTLGSAPGGSHA
TGALGNVSGVCFIGSEGGLLSGNEKVTMQNLNNRLASYLDNVKALEEANSELERKIKTWH
EKYGPGSCRGLDRDYSKYHLTIEDLKSKIISSTAANANIILQIDNARLAADDFRLKYENE
LTLHQNVEADINGLRRVLDELTLCRTDQELQYESLSEEMTYLKKNHEEEMKVLQCAAGGN
VNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFQEKSATLQQQISNDLGAATSA
RTELTELKRSLQTLEIELQSLSATKHSLECSLAETEGNYCSQLAQIQAQISALEEQLHQV
RTETEGQKLEHEQLLDIKAHLEKEIETYCRLIDGDENSCSVSKGFESGTSGNSPKDVSKT
TLVKTVVEEIDQRGKVLSSRIHSIEEKMSKMSNGKAEQRVPF
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtctctccggttttctggcggatccaggcacgttggcatacagtccggatccctcagg
ccgcccagcggaggcgcaggctttgctgggagcagcgtggctggcggttcggttgctggt
agtggattttcttgggctttgggagggacactgggcagtgctcctggtgggagccatgcc
actggtgccctgggaaatgtctctggtgtttgcttcatcggaagtgaagggggtctcctc
tctggaaacgagaaggtcaccatgcagaatcttaacaaccgcttggcctcttacctggat
aacgtaaaagctctggaggaggccaactctgagctagagagaaagatcaagacttggcat
gagaaatacggaccgggatcgtgccgtggacttgaccgtgactacagcaagtatcatcta
accattgaggacctgaaaagcaagatcatctcttccacggctgctaatgctaatataatt
ctgcaaattgataacgccagactggccgcagacgatttccgactaaagtatgaaaacgaa
ctcacccttcaccaaaatgtcgaggcagacatcaatgggttgcggcgcgtccttgacgag
ctaaccctctgcagaacggaccaagagctgcagtacgaatccctgagtgaggagatgact
tatctcaagaagaaccacgaagaggaaatgaaagtcctgcagtgcgcagctggaggcaac
gtgaacgtggagatgaacgcagccccaggcgtggacctcaccgtccttctgaacaacatg
cgagcagagtacgaggccctggctgagcagaaccgcagggacgccgaggcctggttccaa
gagaagagcgccacgctgcagcagcagatctccaatgacttgggcgccgccacctcagcc
aggaccgagctgacagagctgaaacgctccctgcagaccctggagatcgagctgcagtcc
ctctcagctacgaaacactctctggagtgctccctggcggagaccgagggcaactactgc
tcacagctggctcagatccaggctcagatcagcgccctggaggagcagctgcaccaggtg
aggacggagaccgagggccagaagctggaacatgagcagctgctggacatcaaggcccac
ctggagaaggagatcgagacctactgccgcctcatagacggagacgagaattcctgctct
gtctcaaagggttttgaatctggaacctcggggaattcacccaaagatgtatccaaaacc
acactggtgaagacggtggttgaagaaatagatcagcgtgggaaggtgctgtcctccagg
atccactccatcgaggaaaagatgtctaagatgagcaacggcaaggctgagcagagggtt
cccttctag

KEGG   Mus musculus (mouse): 71888
Entry
71888             CDS       T01002                                 

Gene name
Krt33a, 2310015J09Rik
Definition
(RefSeq) keratin 33A
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    71888 (Krt33a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    71888 (Krt33a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    71888 (Krt33a)
   04147 Exosome [BR:mmu04147]
    71888 (Krt33a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     71888 (Krt33a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   71888 (Krt33a)
  Exosomal proteins of other body fluids (saliva and urine)
   71888 (Krt33a)
  Exosomal proteins of colorectal cancer cells
   71888 (Krt33a)
  Exosomal proteins of melanoma cells
   71888 (Krt33a)
SSDB
Motif
Pfam: Filament TPR_MLP1_2
Other DBs
NCBI-GeneID: 71888
NCBI-ProteinID: NP_082259
MGI: 1919138
Ensembl: ENSMUSG00000035592
Vega: OTTMUSG00000002183
UniProt: Q8K0Y2
Position
11; 11 D
AA seq 404 aa
MPYNCCLPAMSCRTSCSSRPCVPPSCHGCTLPGACNIPANVGNCNWFCEGSFNGNEKETM
QFLNDRLASYMEKVRQLERENAELECRIQERNQQQDPLVCPAYQAYFRTIEELQQKILCG
KSENARLVVQIDNAKLASDDFRTKYETELSLRQLVEADINSLRRILDELTLCKSDLEAQV
ESLKEELLCLKQNHEQEVNTLRCQLGDRLNVEVDAAPTVDLNRVLNETRCQYEALVETNR
REVEEWYTTQTEELNKQVVSSSEQLQSCQAEIIELRRTVNALEIELQAQHELRNSLENTL
TESEARYSSQLSQVQCLITNVESQLGEIRADLERQNQEYQVLLDIRSRLECEINTYRGLL
ESEDCKLPCNPCATTNACDKPIGPCVPNPCVTRPRCGPCNTFVR
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgccatacaactgctgcctgcccgccatgagctgccgcaccagctgctcttccaggccc
tgcgtgccccccagctgccatggctgcaccctgcccggggcctgcaacatccccgccaat
gtgggcaactgcaattggttctgtgagggctccttcaatggcaatgagaaggagaccatg
cagttcctgaatgaccgcctggcctcctatatggagaaggtgaggcagctggagagagag
aatgcagagctggaatgtaggatccaggagaggaaccagcagcaggaccccctggtgtgt
cctgcctaccaggcctacttcaggaccattgaggagctgcagcagaagatcttgtgtggc
aaatctgagaacgccaggctggtcgtgcagatcgacaatgccaagctggcttctgatgac
ttcaggaccaagtacgagacagagcttagtctgcggcagctggtagaggctgacatcaac
agcctgcgcaggatcctggatgagctgaccctctgcaagtctgacctggaggcgcaggtg
gagtccctgaaggaggagctgctctgcctcaagcagaatcacgagcaggaagtcaacacc
ctgcgctgccagcttggagaccgcctcaacgtggaggtggacgctgctcccaccgtggac
ctgaaccgagtactcaacgagaccaggtgtcagtacgaggccctggtggaaaccaaccgc
cgggaagtggaggaatggtacaccacacagacagaggagttgaacaagcaggtggtgtcc
agctcagagcagctgcagtcctgccaggccgagatcatcgagctgagacgcacagtcaat
gccctggagatcgagctgcaggcccagcatgaactgagaaactctctggagaacaccctg
acagagagtgaggctcgctacagctcccagctgtcccaggtgcagtgcctgatcaccaat
gtggagtcccagcttggtgagatccgggctgacctggagcgtcagaaccaggagtaccaa
gtgctgctggacattcggtctcgtctggagtgtgagatcaacacgtacaggggcctgctg
gagagcgaggactgcaagctcccttgcaatccctgtgccacaaccaatgcttgtgataag
cccattgggccctgtgtccctaacccttgtgtcacacgacctcgatgtggaccttgcaac
acttttgtgcgttag

KEGG   Mus musculus (mouse): 75706
Entry
75706             CDS       T01002                                 

Gene name
Krt24, 2310058N18Rik, 2310075C18Rik, CK-24, K24
Definition
(RefSeq) keratin 24
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    75706 (Krt24)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    75706 (Krt24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    75706 (Krt24)
   04147 Exosome [BR:mmu04147]
    75706 (Krt24)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     75706 (Krt24)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   75706 (Krt24)
  Exosomal proteins of other body fluids (saliva and urine)
   75706 (Krt24)
  Exosomal proteins of colorectal cancer cells
   75706 (Krt24)
  Exosomal proteins of melanoma cells
   75706 (Krt24)
SSDB
Motif
Pfam: Filament Jnk-SapK_ap_N Lzipper-MIP1 NifU TPR_MLP1_2 HMMR_N
Other DBs
NCBI-GeneID: 75706
NCBI-ProteinID: NP_083669
MGI: 1922956
Ensembl: ENSMUSG00000020913
Vega: OTTMUSG00000006445
UniProt: A1L317
Position
11; 11 D
AA seq 512 aa
MFCSAQKGSCSSRVSSSGAVGSRGCTGGSSFGGGSSCGLGGGSAWGFQGSSNSWSLSGGS
KGSMGGGFGSCSVRGGFGAASSYGGGSGFGGSSGFGGGSGFGGGSGFGGGSSGGFSSYGG
SMGCGLGGVSGYDGGLLSGSEKQTMQDLNDRLANYLDKVRALEEANTDLECKIKDWYGKH
GSVKGGSGRDYSQYYSIIEDLKKQILSATCENARMTLQIDNARLAADDFRMKYEHELCLR
ECLEADINGLRKVLDEMTMTRCDLEMQIEGLTEELVFLRKNHEEEMKCMQGSSGGDVTVE
MNAAPGVDLTKLLNDMRAQYEAMAEQNRQEAERQFNERSASLQAQISSDAGEANCARSEV
MELKRTVQTLEIELQSQLALKCSLEGTLADTEAGYVAQLSGIQAQISSLEEQLSQIRAET
QCQSAEYECLLNIKTRLEQEIETYRRLLNGDGGGCDYRNLVSKNVVLSDSGSCAGQGKDP
SKTRVTKTIIEEVVDGRVVSSQVSNISEVKIK
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgttctgctcagctcagaaagggtcctgctcctcccgagtctcctcctccggggctgtg
ggcagcagggggtgcactgggggaagttcctttggcggtgggagcagctgtgggctaggg
ggaggctctgcctggggcttccaggggagcagcaacagctggagcctgagtgggggatct
aagggtagcatgggagggggcttcggcagctgctcagtaaggggtggattcggagcagcc
tctagctacggtggagggtcgggctttggcgggagctctggctttggtgggggctctggc
tttggtgggggctctggctttggtgggggatctagtggaggcttctctagctatggaggt
agtatggggtgcggtcttggtggcgtcagtggctatgatgggggccttctctctggaagc
gaaaagcaaactatgcaagacctcaatgaccggctagccaactacctagacaaagtccga
gccctggaggaagccaacacggatctggagtgtaaaatcaaggactggtatggcaagcat
gggtctgtaaaaggtgggtctggaagagactacagccaatactactcaatcatcgaagat
ctgaagaagcagatcctttcagccacttgtgaaaacgccagaatgactctgcagattgac
aacgctaggctggctgctgatgacttcagaatgaagtatgagcatgaactctgccttcga
gagtgcttggaggccgacatcaatggcctgcgcaaagtgctggacgaaatgaccatgact
cgctgtgacctggagatgcagattgagggtctgactgaggagctggtcttcctgaggaag
aaccacgaggaggaaatgaagtgtatgcaaggaagctctggaggggatgtgacagtagaa
atgaatgctgccccaggagtcgacctgaccaaactactgaatgacatgagggctcagtat
gaggcgatggccgagcagaaccgccaggaagctgagagacagttcaacgagcggagtgca
tccctgcaagcccaaatctcttcagatgcaggggaagccaattgcgccaggagtgaagta
atggaattgaagcgcacagtgcagaccctggaaattgagcttcagtctcagctggccctg
aaatgctctctggaagggaccctggctgacacagaagctggctatgtggctcagctgtct
ggaatccaggcacagattagcagcctggaggagcagcttagccagatccgggctgagacc
cagtgccagagtgctgagtacgaatgcctgctgaacatcaagacccgcctggagcaggag
attgagacctaccgccgcctgctcaacggagacgggggtggatgtgactatagaaactta
gtatccaagaatgtggtattgagtgactcaggaagctgtgctggccaaggaaaagatccc
agcaagacaagggtgacaaagaccatcatagaggaggtggtggatggtagagttgtctcg
tctcaagtcagcaacatttctgaagtgaaaataaaataa

KEGG   Mus musculus (mouse): 94179
Entry
94179             CDS       T01002                                 

Gene name
Krt23, CK23, Haik1, K23, Krt1-2, Krt1-23
Definition
(RefSeq) keratin 23
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    94179 (Krt23)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    94179 (Krt23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    94179 (Krt23)
   04147 Exosome [BR:mmu04147]
    94179 (Krt23)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     94179 (Krt23)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   94179 (Krt23)
  Exosomal proteins of other body fluids (saliva and urine)
   94179 (Krt23)
  Exosomal proteins of colorectal cancer cells
   94179 (Krt23)
  Exosomal proteins of melanoma cells
   94179 (Krt23)
SSDB
Motif
Pfam: Filament CENP-F_leu_zip POX Jnk-SapK_ap_N BCAS2 TPR_7
Other DBs
NCBI-GeneID: 94179
NCBI-ProteinID: NP_203537
MGI: 2148866
Ensembl: ENSMUSG00000006777
Vega: OTTMUSG00000004988
UniProt: Q99PS0 Q544I8
Position
11; 11 D
AA seq 422 aa
MNSSHSFNQTYSASVHSLGSTRGRQGSCHRAPSVHGGAGGVRISLSFTTPGCLPPGGSWG
SGRSSPLLGGNGKATMQNLNDRLATYLEKVRALEEANSKLETRILRWHQEREPSHRKDYS
QYEENISRLQEQIVDGKMANAHIVVLIDNARMAVDDFNLKFENEHSLKKDLEIEVEGLRK
TLDDLTIVTTDLEQEVEGMRKELILMKKRHEQEMEENHLPSDFKVSVKVDTTPGEDLIKV
LEDMRQEYELIIKKKHQELDTWFREQSAAMAQEVASPAPVQGNQSDIHELRRTFQALEID
LQAQHSRKTALENMLTETRARYSCRLQDMQQIISHYEEELIQLRQDLERQNNEHKVLLGI
KTHLEKEIATYRRLLEGDTEGTMDGSESRLKGSEASTIKAITQESVNGRIVLSQVNEIQK
HI
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgaactccagccacagctttaaccagacctactcggcctctgtccacagcctcggaagc
acccgggggcggcaggggagctgccatcgggcaccgagtgtccatggaggcgcagggggt
gtccgcatctccctttccttcaccacgccaggctgcctgcctcctggaggatcatggggg
tctggaagaagcagtcccctgctaggtggcaatggcaaggccaccatgcagaatctcaac
gatcgcctggccacatatctggagaaggtgcgggctctagaggaggctaactcgaagctg
gaaacccgtatactaaggtggcatcaggagagagaacccagccacagaaaggattattcc
cagtatgaggaaaacatcagccgcctgcaggagcagatagtggacggtaagatggccaat
gcccacattgtcgtgctcattgacaacgccaggatggcagtggatgacttcaacctgaag
tttgaaaacgaacactcgttaaagaaagacttggaaattgaagttgagggcctccgaaag
accttggatgatctgaccattgtcacaacagacctggaacaggaggtggaggggatgagg
aaagagctgatcctcatgaagaaacgccatgagcaggaaatggaggagaatcacttgccg
agtgacttcaaggtcagtgtgaaggtggacactactccaggggaagatctgattaaggtc
ttggaagatatgaggcaggaatacgagttaataataaagaagaaacatcaagagttggac
acctggttcagagagcagtcagccgccatggcccaggaagtggccagtccagcgcctgta
cagggcaaccaaagtgatatccatgagctgaggagaacattccaggccctagagattgac
ctgcaggcccagcacagcaggaaaaccgctttggaaaacatgctgacagagacccgggct
cgatactcctgccgtctccaggacatgcagcagatcatctcccactacgaagaagagctg
attcagctccgccaagacctggagcgtcagaacaatgaacacaaggtgctgctgggcatc
aaaacccacctggagaaggaaatcgccacctaccgccggctcctggagggagacactgaa
gggacgatggatggatctgagtcaaggctgaaaggatctgaagcttcaacgatcaaggcc
atcactcaagagagtgtcaatggaagaatcgttctttctcaagtgaatgagatccaaaag
catatatga

DBGET integrated database retrieval system