KEGG   Mus musculus (house mouse): 107684
Entry
107684            CDS       T01002                                 
Symbol
Coro2a, 9030208C03Rik, IR10
Name
(RefSeq) coronin, actin binding protein 2A
  KO
K13887  coronin-2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    107684 (Coro2a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     107684 (Coro2a)
SSDB
Motif
Pfam: DUF1899 WD40_4 WD40 ANAPC4_WD40 NBCH_WD40 Calpain_III
Other DBs
NCBI-GeneID: 107684
NCBI-ProteinID: NP_001158276
MGI: 1345966
Ensembl: ENSMUSG00000028337
UniProt: Q8C0P5 B1AVH4
Position
4:complement(46536937..46601929)
AA seq 524 aa
MSWHPQYRSSKFRHVYGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAF
LVIPLHQTGKLDPHYPKVCGHRGNVLDIKWNPFNDFEIASCSEDATIKIWNIPKQLLTRN
LTTYRKELIGHARRVGLVEWHPTTANILFSAGYDYKVMVWNLDTKDSVIAGPVKTINCHQ
DVILSMSFNTNGSLLATTCKDRKIRIVDPRLGIVLQEASYKGHRANKVLFLGSLKKLLST
GTSRWNNRQMALWDQENLSVPLTEEDLDGSSGVLFPFFDSDTSMLYIVGKGDGNIRYYEV
SMEKPHLTYLTEYRSYNPQKGIGIMPKRGLDVSSCEIFRFYKLITTKSLIEPVSMIVPRR
SESYQEDIYPPTAAAQPSLTAHEWLSGMNRGPIMMSLRPGSELLDSQTLPPERPLSNSMV
QVSPQPLEPMKQPAEDGDQAPFSLLEEKLAKWTAEHHLGEKSCLTNGFDVFECSPPKTEN
ELLQMFYRQQEEIRRLRELLIQREVQTKQLELEIKNLRMALGQL
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtcatggcacccccagtaccgcagctccaagttccgtcatgtctacggcaagcccgcc
agcaaagagaactgctacgactctgtgcccatcacacgcagcgtccacgacaaccacttc
tgtgccgtgaacccccacttcatcgctgtggtcactgaatgtgccggcgggggcgccttc
cttgtcatccccctgcaccagacgggaaagttggaccctcactaccccaaagtctgtggg
cacagagggaacgtcttggacatcaaatggaatcctttcaatgactttgagattgcctcc
tgttctgaagatgccacgattaagatctggaacatccccaagcaactgttgacaaggaac
ctcacaacctacaggaaggagctgatcggccatgctcgcagggtggggctggtggagtgg
caccccacaactgccaacattctcttcagtgctggctatgactacaaggtgatggtgtgg
aacctggacacaaaggattctgtcattgctgggccagtgaagacaatcaactgtcaccaa
gatgtgatcctctccatgtcctttaacaccaacggcagcctgctggccaccacctgtaag
gaccgcaagattcggattgttgacccccgactagggattgtcctccaggaagccagctac
aaggggcaccgcgccaacaaagtactgttcctggggagcctcaagaagctgctatccacg
ggtacctcccgctggaacaaccggcagatggccctgtgggaccaggaaaacctttctgtg
ccccttacagaggaagacctggatggctcttctggtgtgctgttccccttctttgactcg
gacaccagcatgctgtacattgtggggaagggagacgggaacatccgctactatgaggta
agcatggagaaacctcacctgacctacctgaccgagtaccgctcctacaacccacagaag
gggatcggtatcatgccaaagagaggtctcgatgtgtcttcctgcgagatcttccgcttc
tataaactgatcacaaccaaaagcctcatcgagccagtgtccatgattgtaccccgaagg
tcagaatcctaccaagaggacatctacccgcccaccgcagcggcccagccctccctgacg
gctcatgagtggctcagcgggatgaacagagggcctatcatgatgtcccttagacccggc
tccgagctgctggactcccagacactgcctccagagagacccctctccaattctatggtc
caagtttcacctcagcccttagaacccatgaaacagccggccgaagacggtgaccaggcg
cccttctctctactggaagagaagctagcaaagtggaccgcagagcatcatctgggagag
aagtcctgcctcactaatggctttgatgttttcgaatgctccccaccaaagacagaaaat
gagctgctgcagatgttctaccggcaacaggaggagatccggaggctccgggagctgtta
atccagagagaagtccagaccaagcagctggaactagagatcaaaaacctgcggatggcc
ttaggacagctctga

DBGET integrated database retrieval system