KEGG   Mus musculus (mouse): 107746
Entry
107746            CDS       T01002                                 

Gene name
Rapgef1, 4932418O06Rik, C3G, Grf, Grf2
Definition
(RefSeq) Rap guanine nucleotide exchange factor (GEF) 1
  KO
K06277  Rap guanine nucleotide exchange factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04510  Focal adhesion
mmu04722  Neurotrophin signaling pathway
mmu04910  Insulin signaling pathway
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107746 (Rapgef1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107746 (Rapgef1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107746 (Rapgef1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107746 (Rapgef1)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    107746 (Rapgef1)
SSDB
Motif
Pfam: RasGEF RasGEF_N
Other DBs
NCBI-GeneID: 107746
NCBI-ProteinID: NP_001034175
MGI: 104580
Ensembl: ENSMUSG00000039844
Vega: OTTMUSG00000012043
UniProt: Q3UHC1 Q3UGX8 Q8C5V7
Position
2 B; 2 20.32 cM
AA seq 1218 aa
MSSGLGLRRSPEMSGKIEKADSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSKIP
EKPVSKNLCWLEEKEKEVVSALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQTD
PRIQHSSALSSCYSRVYQSLANLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKEL
VRLTIEKQGRPSPTSPVKPSSPASKPDGQPELPLTDREMEILNKTTSVSPSAELLPDSTS
EEVAPPKPPLPGIRVVDNSPPALPPKKRQSAPSPTRVAVVAPMSRATSGSSLPVGINRQD
FDVECYTQRRLSGGSRSCGGESPRLSPCSSTGKLSRSDEQLSSLDRDSGQCSRNTSCETL
DHYDPDYEFLQQDLSNADQIPPQAACNLSPLPESLGESGPPFLGHPFQLPLGSCLQQEGQ
QTDTPPALPEKKRRSAVSQTTDSSGCRVSYERHPSQYDNISEGDLQNPVPVQPVPYPPFA
AVLPFQQGASSASAEFVGDFSVPELAGDTEKPPPLPEKKNKHMLAYMQLLEDYSEPQPSM
FYQTPQSEHIYQQKNKMLMEVYGFSESFCGSDSTQELAPPPALPPKQRQLQASYAASSFS
VSYCVQQTKVAFTPEDGSAAQGLSVSVSNSFLNRHGSLPVPSYKSVFRSYSQDFMPHHQA
SVQPFLPPTSSSSPHFPPVHTSQSSDLAVPTVSSPPPSTVDGPLSSSQDSSFHGNPVRLP
SETSFTDSSEKASSEEAGGDEYVSLYSSGQTSEELAPCRGEPPSGKDGHPRDPSVSSASG
KDSRENGERSPKSLDGLESAQSEEEVDELSLIDHNEIMARLTLKQEGDDGPDVRGGSGDI
LLVHATETDRKDLVLYCEAFLTTYRTFISPEELIKKLQYRYEKFSPFADTFKKRVSKNTF
FVLVRVVDELCLVELTEEILKLLMELVFRLVCSGELSLARVLRKNILDKVDQKKLLRCAH
SDQPLAARGVAARPGTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNL
TQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSA
PIRRLEWQRQTSEGLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGN
PDYIDGKVNFSKRWQQFNILDSMRCFQQAHYEIRRNDDIINFFNDFSDHLAEEALWELSL
KIKPRNITRRKTDREEKT
NT seq 3657 nt   +upstreamnt  +downstreamnt
atgagcagcggcctcggcctccggcgcagcccggaaatgtccggcaagatcgagaaagca
gactctcagcgttctcatctctcctccttcaccatgaagctgatggacaaattccactct
cccaaaatcaagagaacaccatccaagaagggaaagccagccgaggtgtcgaagattcct
gagaagcctgtgagcaaaaacctgtgctggctggaggagaaagagaaggaggttgtcagt
gccttgcgctactttaagaccattgtggacaaaatggccattgataagaaggttctggag
atgctcccggggtcagccagcaaggtgctggaggccatcttacccctggtgcagactgac
cctcggatccagcacagctcagccctctcctcctgttatagccgagtataccagagcctc
gccaaccttatccgatggtctgaccaggtgatgctagagggcgtgaactcagaagataag
gagatggtgacaactgtgaagggcgttatcaaagctgtcctggacggagtgaaggagcta
gtgaggctaaccattgagaagcaggggcggccatcgccaacaagcccagtgaagcccagt
tccccagccagcaagcctgatggccagcctgagctccctctgacagaccgagaaatggag
attctgaacaagacgacaagtgtgtcaccatctgctgaactgctcccagactccaccagt
gaagaggtcgcaccccccaagccccctttacctggcatccgggtggttgataacagtcca
ccagcattaccacccaagaaaaggcagtctgctccatcccccactcgggtggctgtggta
gccccaatgagtcgggctaccagtggctccagtttgcctgttggaatcaataggcaggac
tttgatgttgaatgttacacccagaggcgcctgtcaggaggcagccgctcctgcggtggt
gagtctcctcgcctgtccccctgcagcagcacaggcaagctcagccgctcagacgagcag
ctgtcctccctggacagggatagtgggcagtgctcacggaacacaagctgtgaaacacta
gatcactacgaccccgactatgaattcctccagcaagatctctccaatgcagaccagatc
cctccacaggcagcctgtaacctcagccctctgccggagtccctgggggaatctgggcct
ccatttcttggccaccctttccagctgcctttgggcagctgtctgcagcaggagggacag
cagacagacactccacctgcccttccggagaagaagcgtaggagcgcagtctcccagacc
acggacagctctggctgcagggtgtcctatgagcgacacccctcacagtatgacaacatc
tcagagggtgacctgcagaacccagtcccagtccagcctgtgccctacccaccctttgct
gctgtcctgccctttcagcagggagcttcctctgcctctgctgagtttgtgggtgatttc
agtgttcctgagttggcgggtgacacagagaagccacctcctctaccagagaagaagaac
aagcacatgctggcctacatgcaactgctggaggactactcagagccacagccctccatg
ttctaccagacaccgcagagtgagcacatctaccagcagaagaacaagatgctcatggag
gtgtacggcttcagcgagtccttctgcggtagtgattccacgcaggagctggcccctcca
cccgctctgccccccaagcaacggcagctgcaggcctcctatgctgcttcttccttctct
gtctcctactgtgtccagcaaactaaagtggccttcacccccgaggacggcagtgccgct
cagggcctcagtgtatccgtgtctaactcctttctcaaccggcacggcagcttgcctgtg
ccctcgtacaaatctgtgtttaggtcttactcccaggacttcatgcctcaccaccaagcc
tccgtccaacctttccttccgcctacctcctcttcctctccacatttcccacctgtccac
acgtcccagagctcggacttagcggtgcccaccgtaagcagtccgcctcccagcaccgtg
gacgggcctctctcgtcttctcaggacagcagctttcatgggaaccctgtccgccttcct
tccgaaacctctttcactgactcgagtgaaaaggccagcagtgaggaagctggtggggat
gagtatgtcagtctgtactcctctggccagaccagcgaggagctggctccctgtcgagga
gaaccaccatctgggaaggacggacatcccagagatccttcggtcagcagtgcatctggg
aaggacagcagagaaaatggggaaaggtccccaaagtcactggatggtctggagtcagcg
cagtcagaagaggaagtggatgaactgtccctcattgaccacaatgaaattatggccagg
ctgacactcaagcaagagggtgatgatgggccagatgttcgtggtggttcaggagacatc
ttactggtccatgctactgagacagacagaaaagacctggtgctgtactgtgaagccttc
ctgaccacctacaggaccttcatcagcccggaggagctcatcaagaagctgcagtaccgg
tacgagaagttctctccctttgctgacacgttcaagaagcgagtgagcaagaacacattc
tttgtgctggttcgagtggtggatgagctctgcctggtggagctgacagaggagatcctg
aagctgctgatggagctggtcttccgcctagtgtgcagcggagagctcagcctggccaga
gtcctccggaagaacattctggacaaggtggaccagaagaagctgctcaggtgtgcccat
tccgaccagcctctggcagccaggggtgttgcagccaggccaggaaccttgcatgatttc
cacagccacgagatagctgagcagctgacactgctggatgccgagcttttctacaagata
gagattcctgaagttttgctttgggccaaagagcagaatgaggagaagagtcccaatctg
acccagttcacagagcacttcaacaacatgtcctactgggtgcggtccatcatcatgctg
caggagaaggcccaggaccgggagaggctgctcctcaagttcatcaagatcatgaagcac
ctgcgcaagctcaacaacttcaactcctacctggccatcctctcagcactagactcggcc
cccatccgcagactggagtggcagcggcagacctcagagggcctggctgagtactgcaca
ttgattgacagctcatcctccttccgagcctaccgggctgctctctcagaggtggagccc
ccatgtatcccatacctaggtctgattctgcaagacctgaccttcgttcacctgggaaac
ccagattatattgacgggaaagtaaacttctccaagcggtggcaacagttcaacatattg
gacagcatgcggtgcttccagcaggcgcactatgaaatccggagaaacgacgacatcata
aatttcttcaatgacttcagtgaccacctggccgaggaagccctgtgggaactctctctg
aagatcaagcctaggaacataacaaggcggaaaacagaccgcgaagagaagacctag

DBGET integrated database retrieval system