KEGG   Mus musculus (mouse): 107769
Entry
107769            CDS       T01002                                 

Symbol
Tm6sf1, AI428514, BC023123, C630016D09Rik
Name
(RefSeq) transmembrane 6 superfamily member 1
  KO
K25361  transmembrane 6 superfamily
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    107769 (Tm6sf1)
SSDB
Motif
Pfam: EBP
Other DBs
NCBI-GeneID: 107769
NCBI-ProteinID: NP_663350
MGI: 1933209
Ensembl: ENSMUSG00000038623
Vega: OTTMUSG00000024529
UniProt: P58749
Position
7; 7 D3
AA seq 370 aa
MSASAATGVFVLSLSAIPVTYIFNHLAAQHDSWTIVGVAALILLLVALLARVLVRRKPPR
DPLFYVYAVFGFTSVVNLIIGLEQDGIIDGFMTHYLREGEPYLNTAYGHMICYWDGSVHY
LMYLVMVAAIAWEESYRTIGLYWVGSIIMSIVVFVPGNIVGKYGTRICPAFFLSIPYTCL
PVWAGFRIYNQPSENYNYPSKVLQEAQAKALLRRPFDLVLVLCLFLATGFCLFRGLIALD
CPAELCRLYTQFQEPYLKDPAAYPKIQMLAYMFYSVPYFVIALYGLVVPGCSWMPDITLV
HAGGLAQAQFSHIGASLHARTAYVYRVPEEAKIFFLALNIAYGVLPQLLAYRCTYNPEFF
LRTKADEKLE
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgagtgcctctgcggccacgggggtttttgtgctgtccctctcagccatcccggtcacc
tacatcttcaaccacctggcggcccagcacgattcctggaccattgttggggttgctgcc
ctcatcctgctcctggtggcccttttggcccgggtccttgtcagaagaaaaccaccgagg
gaccctctgttctacgtgtatgcagtgtttggatttaccagtgtggtgaaccttatcata
ggcttggagcaagatggcatcattgatggattcatgacgcactacttgagagagggtgaa
ccgtatctgaacacggcctatgggcacatgatctgctactgggatggctctgttcattac
ctgatgtacctagtgatggtggccgccatagcctgggaggaaagctacagaaccattggc
ctatactgggtcggatccattataatgagcatcgtggtttttgtgcctggaaacatcgta
ggaaagtatgggacacggatttgccctgcatttttcttaagcataccatatacatgtctt
ccggtctgggctggcttcagaatctataatcaaccatcagaaaactataattatccctca
aaggttcttcaagaagcccaagcaaaggccctgctgagaagaccgtttgacttagtgttg
gttttgtgtcttttcttggcaactggattttgcctgttcagaggcttgattgctttggat
tgcccagctgagctctgccgactctacacgcagtttcaagagccctacctaaaggaccct
gctgcttatcctaagattcagatgctggcatacatgttctattccgtcccttactttgtg
attgccctttatggcttagtggtccctggatgctcatggatgcctgatataacgctggtc
catgctggaggtctagctcaggctcagttttctcacattggtgcgtcccttcatgctaga
actgcttatgtctacagagtccccgaagaagcgaaaatcttttttctagcactaaacata
gcatatggagttcttcctcagctcttggcctaccgttgtacctacaatcccgagttcttc
ctaagaactaaggcagatgagaagttggaataa

DBGET integrated database retrieval system