KEGG   Mus musculus (mouse): 107817Help
Entry
107817            CDS       T01002                                 

Gene name
Jmjd6, 5730436I23Rik, D11Ertd195e, PSR, PtdSerR, Ptdsr, mKIAA0585
Definition
(RefSeq) jumonji domain containing 6
  KO
K11323  histone arginine demethylase JMJD6 [EC:1.14.11.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    107817 (Jmjd6)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     107817 (Jmjd6)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    107817 (Jmjd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC Cupin_8 AF-4 IMUP
Motif
Other DBs
NCBI-GeneID: 107817
NCBI-ProteinID: NP_203971
MGI: 1858910
Ensembl: ENSMUSG00000056962
Vega: OTTMUSG00000003777
UniProt: Q9ERI5
Position
11 E2; 11 81.49 cM
AA seq 403 aa AA seqDB search
MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESYPLNPAAVPDNVERADALQLSVKEFV
ERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEY
MESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPP
RSGTGIHIDPLGTSAWNALVQGHKRWCLFPTNTPRELIKVTREEGGNQQDEAITWFNVIY
PRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTIAITQNFASSTNFPVVWHK
TVRGRPKLSRKWYRILKQEHPELAVLADAVDLQESTGIASDSSSDSSSSSSSSSSDSDSE
CESGSEGDGTTHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacaagagcaagaagcgcatccgcgaggccaagcgaagtgcgcggccggagctc
aaggactcgctcgactggacccggcacaactactacgagagctacccgctgaaccccgcg
gccgtgccggataacgtggagagagctgatgccttacagctgtcggtgaaagagttcgtg
gagcgctacgagaggccttacaagcccgtggttctgctcaatgcacaagagggctggtcc
gcacaggagaaatggactctggagcgcctcaaaaggaaataccggaaccagaagttcaag
tgcggcgaggataatgacggctactcggttaagatgaagatgaagtactacatcgagtac
atggagagcacccgcgatgacagtcccctttacatcttcgatagcagctatggcgaacac
cccaaaagaaggaaacttttggaagactacaaggtgcccaagtttttcacagatgatctt
ttccaatacgcgggggagaaacgcagacccccttacaggtggtttgtgatggggccaccg
cgttctggaactgggattcacatcgaccctctggggaccagtgcctggaatgccttagtt
cagggtcacaagcggtggtgcctcttcccaacaaacacacccagagaactcatcaaggtg
acccgagaagaaggagggaaccaacaggatgaagcaattacctggtttaatgtcatctat
ccccggacacagcttccaacctggccacctgaattcaaacccctggagatattacagaaa
ccaggagaaactgtctttgtaccagggggctggtggcatgttgtcctcaaccttgacacc
accattgccatcacccagaactttgccagcagcaccaacttccctgttgtgtggcacaag
acggtaagagggagaccaaagttatcaaggaagtggtataggatcttgaaacaggagcac
cctgagctggcagtcctggccgacgcagttgacctccaggagtccacaggcattgcctct
gacagctccagcgactcttctagctcctctagttccagctcgtcagactcggactcagag
tgtgaatctgggtcagaaggtgatgggacgacacaccgcaggaagaagaggagaacctgc
agcatggtgggaaatggggacactacctcccaggatgactgtgtgagcaaagagcgcagc
tcctccaggtga

DBGET integrated database retrieval system