KEGG   Mus musculus (house mouse): 107823
Entry
107823            CDS       T01002                                 
Symbol
Nsd2, 5830445G22Rik, 9430010A17Rik, C130020C13Rik, D030027O06Rik, D930023B08Rik, MMSET, Whsc1, Whsc1l, mKIAA1090
Name
(RefSeq) nuclear receptor binding SET domain protein 2
  KO
K11424  [histone H3]-lysine36 N-dimethyltransferase NSD2 [EC:2.1.1.357]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00310  Lysine degradation
mmu01100  Metabolic pathways
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107823 (Nsd2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107823 (Nsd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    107823 (Nsd2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     107823 (Nsd2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107823 (Nsd2)
SSDB
Motif
Pfam: PWWP SET AWS C5HCH HMG_box PHD HMG_box_2 zf-HC5HC2H zf-HC5HC2H_2 MUM1-like_PWWP
Other DBs
NCBI-GeneID: 107823
NCBI-ProteinID: NP_780440
MGI: 1276574
Ensembl: ENSMUSG00000057406
UniProt: Q8BVE8
Position
5:33974286..34055310
AA seq 1365 aa
MEFSIRKSPLSVQKVVKCMKMKQTPEILGSANGKTQNCEVNHECSVFLSKAQLSNSLQEG
VMQKFNGHDALPFLPAEKLKDLTSCVFNGEPGAHDTKLCFEAQEVKGIGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDGAADVSQSEENEQKSDNKTRRNRKRSIKYDSLLE
QGLVEAALVSKISSPADKKIPVKKESCPNTGRDRDLLLKYNVGDLVWSKVSGYPWWPCMV
SADPLLHNHTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEEQFEKLCQESAKQ
APTKAEKIKLLKPISGRLRAQWEMGIVQAEEAASMSIEERKAKFTFLYVGDQLHLNPQVA
KEAGIVTEPLGEMVDSSGASEEAAVDPGSVREEDIPTKRRRRTKRSSSAENQEGDPGTDK
STPPKMAEAEPKRGVGSPAGRKKSTGSAPRSRKGDSAAQFLVFCQKHRDEVVAEHPDASG
EEIEELLGSQWSMLNEKQKARYNTKFSLMISAQSEEDSGNGNGKKRSHTKRADDPAEDVD
VEDAPRKRLRADKHSLRKRETITDKTARTSSYKAIEAASSLKSQAATKNLSDACKPLKKR
NRASATASSALGFNKSSSPSASLTEHEVSDSPGDEPSESPYESADETQTEASVSSKKSER
GMAAKKEYVCQLCEKTGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCTECASGIHSCFVC
KESKMEVKRCVVNQCGKFYHEACVKKYPLTVFESRGFRCPLHSCMSCHASNPSNPRPSKG
KMMRCVRCPVAYHGGDACLAAGCSVIASNSIICTGHFTARKGKRHHTHVNVSWCFVCSKG
GSLLCCEACPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKN
ALQEAEARFNEVKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKP
TDENPCGSDSECLNRMLMFECHPQVCPAGEYCQNQCFTKRQYPETKIIKTDGKGWGLVAK
RDIRKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNYSRFM
NHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSG
FLGDRPKTSASLSSEEKGKKAKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCT
KAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHLCPNSFCKEHQDGTAFRSTQDGQ
SYCCEHDLRADSSSSTKTEKPFPESLKSKGKRKKRRCWRRVTDGK
NT seq 4098 nt   +upstreamnt  +downstreamnt
atggaatttagcatcagaaaaagtcctctttctgttcagaaagttgtaaagtgcatgaag
atgaagcagacaccagaaatccttggcagtgcaaatggaaagactcagaactgtgaagtg
aatcatgaatgttctgtattcctcagcaaagctcaactttctaacagcctacaggagggg
gtcatgcagaaatttaatggccatgatgcgctcccctttcttccagcagagaagttgaaa
gatcttacttcttgtgtttttaatggagaacctggtgctcatgatactaaattgtgtttt
gaggcccaggaagtaaaaggaattgggacaccacccaatactacacctatcaaaaatggc
tctccagaaattaaactgaaaatcaccaaaacatacatgaatgggaaacctctctttgaa
tcttcaatttgtggtgacggtgctgctgatgtgtctcagtcagaagaaaacgaacaaaaa
tctgataataagactaggaggaacaggaagaggagcataaaatatgactctttactggag
cagggccttgtggaagcagctttagtgtccaagatctcaagtcctgcagataaaaagatt
ccagttaagaaggagtcctgtccaaatactggcagagacagagacctcttgttaaaatac
aacgttggtgatttggtgtggtccaaagtgtcaggttacccttggtggccttgcatggtt
tctgctgacccactccttcacaatcataccaaacttaaaggtcagaaaaaaagtgcacgc
cagtatcatgtacagttctttggtgatgccccagaaagagcttggatatttgagaagagc
cttgttgcttttgaaggagaagaacaatttgaaaaattatgccaagaaagtgccaagcag
gcacccacgaaagctgagaaaatcaagttgttgaaacctatttcggggagattgagagcc
cagtgggaaatgggcattgtccaagctgaggaagctgccagcatgtcaatagaggagcgg
aaagccaaatttaccttcctttatgtgggggaccaattgcacctcaaccctcaagtagct
aaggaggctggcattgttacagaacctttgggagaaatggtggactcttcaggggccagt
gaagaggctgctgtagaccctgggtctgtgagagaagaggatattcccacgaagagaagg
cgaagaaccaaaaggtctagttctgctgagaaccaagaaggtgatcctggcacagacaag
agtacacctccaaagatggcagaggctgaacctaagcgaggagtaggctctcctgctggg
aggaaaaagtccacaggctctgctcctcggagcaggaagggagactcagcagcccagttt
ttagtcttttgtcaaaaacacagagatgaggttgtagctgaacatccagatgcctcaggg
gaagagattgaagaattgcttgggtcccagtggagcatgctcaatgaaaagcagaaagca
cgatataatacaaagttttccctaatgatctctgcccagtctgaagaagactctggaaat
gggaatgggaaaaaaagaagccacacaaagagagcagatgaccctgcagaggatgtggat
gttgaagacgcgcccaggaaaagacttagagcagataagcacagtcttcggaagagagag
acaatcaccgacaaaacggccagaacaagctcttacaaggctatagaggcagcctcctca
ctcaagagccaggcagcaacgaaaaatttgtctgatgcttgcaaaccactgaagaagcga
aatcgggcttctgcaacagcgtcttcagcacttgggtttaacaaaagttcatctccttct
gcatccttaactgagcatgaggtctcagacagcccaggagatgaaccatcagagtctcca
tatgaaagtgcagatgaaacacagactgaagcatccgtctcatctaaaaaatctgaaaga
ggaatggctgccaaaaaggagtacgtgtgtcagctgtgtgagaagacaggcagtctctta
ctgtgtgagggcccctgttgtggagcattccacctagcctgccttggactttcccgaaga
ccggaaggaagattcacctgcaccgaatgtgcctcagggattcactcatgcttcgtatgt
aaagaaagcaagatggaggtgaaacgttgtgtggtaaatcagtgtggaaagttttaccat
gaagcctgtgtaaaaaaataccctctcactgtgtttgagagccgaggcttccgctgtcct
ctccatagctgtatgagctgccatgcctccaacccttcaaatccacggccatcaaaaggt
aaaatgatgcgatgtgtccgatgccccgttgcctatcatggaggggatgcctgtctggca
gcaggatgttcggtgattgcttctaacagcataatctgcacaggccacttcactgcccgg
aaggggaagcggcaccatacccatgtcaatgtgagctggtgctttgtgtgctccaaaggg
ggaagccttctgtgctgtgaggcctgcccagcagcctttcaccccgattgtctaaacatc
gagatgcccgatggtagctggttctgcaacgattgccgggctggaaagaagctccacttt
caagacatcatctgggtcaaacttggtaactacagatggtggccggcagaagtttgccat
cccaaaaatgttcccccaaatattcagaaaatgaagcacgagattggagaattccctgta
tttttctttgggtctaaagattattactggacgcatcaggcacgagtgttcccatacatg
gagggggaccggggcagccgctaccagggggtcagagggatcggaagagtcttcaagaac
gcattgcaagaagctgaagctcgttttaatgaagtcaaacttcagcgggaagcccgagaa
acacaggagagtgagagaaagcctccaccatacaagcatatcaaggtgaataaaccttat
ggtaaagtccagatctacacagctgacatttctgaaatcccgaagtgcaactgtaagccc
acagatgagaacccctgtggctctgattcagagtgtctgaacaggatgctaatgtttgag
tgccacccgcaggtgtgtcctgcaggggaatactgccagaaccagtgtttcactaagcgc
cagtaccctgagaccaagatcatcaagacagatggcaaagggtggggcctggttgccaaa
agggacatcagaaaaggagaatttgttaatgagtatgttggtgagctgattgatgaagag
gagtgtatggcaagaatcaaatatgcacatgagaatgacatcactcacttctacatgctc
accatagacaaggaccgcataattgatgctggccccaaagggaattattcacgattcatg
aaccatagctgccagcccaattgtgagaccctgaagtggacagtgaatggggacacacgg
gttggcctgtttgctgtgtgtgacattcctgcaggtacagagctgactttcaactataac
cttgattgtttgggcaatgaaaagacagtctgtcggtgtggagcctccaactgtagtggg
ttccttggagacagaccaaagacatcagcatccctttcatcagaggaaaagggtaaaaag
gccaagaagaaaaccagaaggcgcagagccaagggtgaaggaaaacggcagtcagaggat
gagtgcttccgctgtggtgatggtgggcagctggtgctgtgtgaccgcaagttctgtacc
aaggcctaccacctatcctgcctcggtttgggcaagcggccctttgggaagtgggaatgt
ccttggcatcactgtgatgtatgtggcaaaccttctacctcattttgccacctctgcccc
aactcattctgtaaggaacaccaagatgggactgctttccgttccacccaggatgggcag
tcctactgctgtgagcatgacttgagggcagactcttcaagtagcaccaagactgagaaa
ccctttccagaatcactgaagtcaaaaggaaagaggaagaaaaggcggtgctggcgaagg
gtcacagatggcaaatag

DBGET integrated database retrieval system