KEGG   Mus musculus (mouse): 107869Help
Entry
107869            CDS       T01002                                 

Gene name
Cth, 0610010I13Rik, AI314617, BC019483, CSE, Cys3
Definition
(RefSeq) cystathionase (cystathionine gamma-lyase)
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00260  Glycine, serine and threonine metabolism
mmu00270  Cysteine and methionine metabolism
mmu00450  Selenocompound metabolism
mmu01100  Metabolic pathways
mmu01230  Biosynthesis of amino acids
Module
mmu_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    107869 (Cth)
   00270 Cysteine and methionine metabolism
    107869 (Cth)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    107869 (Cth)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    107869 (Cth)
Enzymes [BR:mmu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     107869 (Cth)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107869 (Cth)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 GDC-P Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 107869
NCBI-ProteinID: NP_666065
MGI: 1339968
Ensembl: ENSMUSG00000028179
Vega: OTTMUSG00000029713
UniProt: Q8VCN5
Position
3; 3 H4
AA seq 398 aa AA seqDB search
MQKDASLSGFLPSFQHFATQAIHVGQEPEQWNSRAVVLPISLATTFKQDFPGQSSGFEYS
RSGNPTRNCLEKAVAALDGAKHSLAFASGLAATITITHLLKAGDEIICMDEVYGGTNRYF
RRVASEFGLKISFVDCSKTKLLEAAITPQTKLVWIETPTNPTLKLADIGACAQIVHKRGD
IILVVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGLVSVNSDDLNSRLRFLQN
SLGAVPSPFDCYLCCRGLKTLQVRMEKHFKNGMAVARFLETNPRVEKVVYPGLPSHPQHE
LAKRQCSGCPGMVSFYIKGALQHAKAFLKNLKLFTLAESLGGYESLAELPAIMTHASVPE
KDRATLGINDTLIRLSVGLEDEQDLLEDLDRALKAAHP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggacgcctctttgagcggcttcctgcctagtttccagcatttcgccactcag
gccatccacgtgggacaagagcctgagcaatggaattctcgtgccgtggtgctgcccatt
tcgttggccaccacatttaagcaggacttcccgggccagtcctcgggttttgaatacagc
cgctctggaaatccaacaaggaattgcttggaaaaagcagtggctgcgttggatggggca
aagcacagtttggcctttgcatcgggtcttgctgccaccattacgattacccatctttta
aaagcaggagatgaaatcatttgcatggatgaagtgtatggaggcaccaacaggtacttc
aggagggtggcatctgaatttggactgaagatttcttttgtagattgttccaaaaccaaa
ttgctagaggcagcgattacaccacaaaccaagcttgtttggatcgaaacacccacaaac
ccaactttgaagttggctgacattggagcctgcgcacaaattgtccacaaacgtggagac
atcattttggttgtagataacaccttcatgtctgcatatttccagagacctttggctctg
ggtgctgatatttgtatgtgttctgccacaaaatacatgaatggccacagcgatgttgtc
atgggtttagtgtctgttaattctgatgacctcaatagtcggcttcgtttcctgcagaat
tcactaggagcagttccttctccttttgattgttacctctgctgccgaggcctgaagaca
ctgcaggtccggatggagaaacatttcaagaatgggatggcggtggctcgtttcctggag
accaatccccgggtagaaaaggttgtttatcctgggctaccctctcaccctcagcatgag
ctggccaaacgccagtgctcgggctgcccagggatggtcagtttctacatcaagggtgct
ctgcagcatgctaaggccttcctcaaaaatctaaagctgtttactctggcagagagcctg
ggaggatatgagagtctggctgagcttccagcaatcatgacccatgcctctgtgcctgag
aaggacagagctaccctcgggatcaatgacacactgatacgactttctgtgggcctagag
gatgaacaggaccttcttgaagacctggatcgagctttgaaggcagcgcacccttaa

DBGET integrated database retrieval system