KEGG   Mus musculus (mouse): 107995
Entry
107995            CDS       T01002                                 

Gene name
Cdc20, 2310042N09Rik, C87100, p55CD, p55CDC
Definition
(RefSeq) cell division cycle 20
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107995 (Cdc20)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107995 (Cdc20)
   04114 Oocyte meiosis
    107995 (Cdc20)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107995 (Cdc20)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107995 (Cdc20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    107995 (Cdc20)
   03036 Chromosome and associated proteins [BR:mmu03036]
    107995 (Cdc20)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     107995 (Cdc20)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107995 (Cdc20)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 ELYS-bb nos_propeller Hira
Other DBs
NCBI-GeneID: 107995
NCBI-ProteinID: NP_075712
MGI: 1859866
Ensembl: ENSMUSG00000006398
Vega: OTTMUSG00000008798
UniProt: Q9JJ66
Position
4; 4 D2.1
AA seq 499 aa
MAQFVFESDLHSLLQLDAPIPNAPVARWQRKAKEATGPAPSPMRAANRSHSAGRTPGRTP
GKSSSKVQTTPSKPGGDRFIPQRSASQMEVASFLLSKENQPEDRGTPTKKEHQKAWSLNL
NGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPE
IRNDYYLNLVDWSSGNVLAVALDNSVYLWNAGSGDILQLLQMEQPGDYISSVAWIKEGNY
LAVGTSNAEVQLWDVQQQKRLRNMTSHSARVSSLSWNSYILSSGSRSGHIHHHDVRVAEH
HVATLSGHSQEVCGLRWAPDGRHLASGGNDNIVNVWPSGPGESGWAPLQTFTQHQGAVKA
VAWCPWQSNILATGGGTSDRHIRIWNVCSGACLSAVDVHSQVCSILWSPHYKELISGHGF
AQNQLVIWKYPTMAKVAELKGHTARVLGLTMSPDGATVASAAADETLRLWRCFEMDPALR
REREKASVAKSSLIHQGIR
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcgcagttcgtgttcgagagcgatttgcactcactgcttcaactggacgcacccatc
cccaatgccccggttgcgcgctggcagcgcaaagcaaaggaagccacaggcccagccccc
tcgcccatgcgggccgccaacagatcacacagcgccgggcggaccccgggccgaactcct
ggcaaatctagttccaaggttcagaccacccctagcaaacctggaggtgaccgctttatc
ccccaacgcagtgcttctcaaatggaggtggccagcttcctcttaagcaaggaaaaccag
ccggaagacagggggacgcccaccaaaaaggagcatcagaaagcctggtctctcaacctg
aacggttttgatgtggaggaagccaagatcctcaggctcagcggcaaacctcagaatgcc
ccagaaggctaccagaacagactgaaagtactgtacagtcagaaagccacgcctggctcc
agcaggaagacttgcagatacatcccttctctgccagacaggatccttgatgcccccgaa
atccggaatgactactacctgaatcttgtagattggagctctggaaatgtattggctgtg
gcactggacaacagtgtgtacttatggaacgctggttctggtgacatcctgcagttgttg
caaatggagcagcctggagactacatatcctcggtggcctggatcaaggagggcaactac
ctagctgtaggcaccagcaatgctgaggtccagctctgggatgtgcagcagcagaaacga
cttcgaaacatgaccagtcactccgctcgagtaagctccctcagttggaacagctatatc
ctatccagtggttcacggtctggccacatccaccaccatgatgttcgggtagcagaacac
catgtggccacactgagtggccatagccaggaagtatgtgggcttcgctgggccccagat
ggacgacatctggcaagtggtggcaatgataacattgtcaacgtgtggcctagtggtcct
ggagaaagtggatgggctcccctgcaaacattcactcaacatcaaggcgctgtcaaggct
gtggcatggtgtccctggcagtccaatatcctggcaacaggaggaggaaccagtgaccgg
cacattcgcatttggaacgtctgctcaggggcctgtctgagtgctgtggatgtgcattcc
caggtgtgctccatcctctggtctccccactataaggagctgatctcaggtcacggcttt
gcccagaaccagctggttatttggaagtatccaaccatggccaaggtggctgagctcaaa
ggacacacagcacgggtcctgggtcttacaatgagtccagatggggccacagtggcatca
gcagcagctgatgagactctacggttgtggcgctgctttgagatggaccctgcccttcgg
cgtgagcgggaaaaagccagtgtagctaaaagtagcctcatccaccaaggcatccgttga

DBGET integrated database retrieval system