KEGG   Mus musculus (mouse): 108012Help
Entry
108012            CDS       T01002                                 

Gene name
Ap1s2, 1500012A13Rik, AI853648, EST1
Definition
(RefSeq) adaptor-related protein complex 1, sigma 2 subunit
  KO
K12394  AP-1 complex subunit sigma 1/2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    108012 (Ap1s2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108012 (Ap1s2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    108012 (Ap1s2)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    108012 (Ap1s2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clat_adaptor_s DUF629 PulA_N1
Motif
Other DBs
NCBI-GeneID: 108012
NCBI-ProteinID: NP_001277308
MGI: 1889383
Ensembl: ENSMUSG00000031367
Vega: OTTMUSG00000019515
UniProt: Q9DB50
Position
X; X F5
AA seq 160 aa AA seqDB search
MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKR
YASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGG
EVQETSKKNVLKAIEQADLLQEDAKEAETPRSVLEEIGLT
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttatgttgctttttagtcgccagggaaagcttcgactgcagaaatggtatgtc
ccactgtcagacaaagaaaagaagaagatcacaagagaacttgttcaaaccgttttagca
cggaaacccaagatgtgcagcttccttgagtggagagatctgaagattgtttataaaaga
tatgccagtctatatttttgctgtgctattgaggatcaggacaatgaactgattaccctg
gaaataatccatcgttacgtggaattacttgacaagtattttggcagtgtatgtgaactt
gatatcatctttaattttgagaaggcctattttattttggatgaatttctcttgggagga
gaagttcaggaaacatccaagaaaaatgtccttaaagcaattgagcaggccgatctcctg
caggaggatgcaaaagaagctgaaaccccacgtagtgttcttgaagaaattggactgaca
taa

DBGET integrated database retrieval system