KEGG   Mus musculus (house mouse): 108014
Entry
108014            CDS       T01002                                 
Symbol
Srsf9, 25kDa, 2610029M16Rik, SRp30c, Sfrs9
Name
(RefSeq) serine and arginine-rich splicing factor 9
  KO
K21123  serine/arginine-rich splicing factor 9
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03040  Spliceosome
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108014 (Srsf9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108014 (Srsf9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    108014 (Srsf9)
Spliceosome [BR:mmu03041]
 Common components
  Common spliceosomal components
   SR proteins
    108014 (Srsf9)
SSDB
Motif
Pfam: RRM_1 Nup35_RRM_2 RRM_3 RRM_7 RRM_occluded
Other DBs
NCBI-GeneID: 108014
NCBI-ProteinID: NP_079849
MGI: 104896
Ensembl: ENSMUSG00000029538
UniProt: Q9D0B0
Structure
Position
5:115465236..115471139
AA seq 222 aa
MSSGWADERGGEGDGRIYVGNLPSDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRF
EDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGARNGPPTRRSDFRVLVSGLP
PSGSWQDLKDHMREAGDVCYADVQKDGMGMVEYLRKEDMEYALRKLDDTKFRSHEGETSY
IRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtcgtcgggctgggcggacgagcgcggcggcgagggcgacgggcgcatctacgtgggc
aaccttccgtccgacgtgcgcgagaaggacctcgaggacttgttctacaagtacggccgc
atccgcgagatcgagctcaagaaccggcacggcctcgtgcccttcgccttcgtgcgcttc
gaggacccgcgagatgctgaggatgcgatctatggaagaaacggttacgattatggccag
tgtcgactccgtgtggagttccccaggacttacggaggtcggggtgggtggccccgtggt
gcaaggaacgggcctcctacaagacggtcagatttccgagttcttgtttcaggacttcct
ccatcaggcagctggcaggacctgaaagatcacatgcgagaagctggggatgtctgttat
gcagacgtacagaaggacggaatggggatggttgaatatttgagaaaagaggacatggaa
tatgctctgcgtaaactggatgacaccaaattccgctctcacgagggtgagacttcctac
atccgagtgtatcctgagagaagcaccagctatggctactcacggtcgcggtctgggtcc
aggggccgcgactcgccataccaaagccggggctcgccacactacttctctcctttcagg
ccctactga

DBGET integrated database retrieval system