KEGG   Mus musculus (mouse): 108015
Entry
108015            CDS       T01002                                 

Gene name
Chrnb4, Acrb-4, Acrb4
Definition
(RefSeq) cholinergic receptor, nicotinic, beta polypeptide 4
  KO
K04815  nicotinic acetylcholine receptor beta-4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108015 (Chrnb4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    108015 (Chrnb4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    108015 (Chrnb4)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   108015 (Chrnb4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Other DBs
NCBI-GeneID: 108015
NCBI-ProteinID: NP_683746
MGI: 87892
Ensembl: ENSMUSG00000035200
Vega: OTTMUSG00000063102
UniProt: Q8R493 Q3USV2
Position
9; 9 B
AA seq 495 aa
MRGTPLLLVSLFALLQPGDCRLANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELS
LSQLISVNEREQIMTTSIWLKQEWTDYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNA
DGTYEVSVYTNVIVRSNGSIQWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEI
DMVLKSPTAIMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLII
PCVLITSLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLF
TMVLVTFSIVTTVCVLNVHHRSPSTHTMASWVKECFLHKLPTFLFMKRPGLEVSPARVPH
SSQLHLTTAEATSTSALGPSSPSNLYGNSMYFVNPVPATPKSAVSSHTAGLPRDARLRSS
GRFRQDLQEALEGVSFIAQHLESDDRDQSVIEDWKFVAMVVDRLFLWVFVIVCILGTMGL
FLPPLFQIHAPSKGL
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgaggggtacgcccctgctcctcgtctctctgttcgctctgcttcagcctggggactgc
cgcctggccaacgcagaggagaagctgatggatgatctcctgaacaaaacccgctacaac
aacctgatccgcccagccaccagctcctcccagctcatctccatccgcctggagctatca
ctgtcccagctcatcagtgtgaatgagcgagaacagatcatgaccaccagcatctggctg
aaacaggaatggactgactaccgcctggcctggaacagctcctgctatgaaggggtgaac
attctgaggattcctgcaaagcgagtctggttgcctgacatcgtgttgtacaacaatgcc
gatgggacctatgaggtgtctgtctacaccaacgtgatcgtgcgttccaacggcagcatc
cagtggctgccccctgccatctacaagagtgcctgcaagatagaggtgaagcactttccc
ttcgaccagcagaactgcaccctcaaatttcgctcctggacctatgaccacacagagatt
gacatggttcttaaatcacccacagccatcatggatgactttacccccagcggtgaatgg
gacattgtggccctcccgggtcgaaggacagtgaacccacaggaccccagctatgtggac
gtgacctatgacttcatcatcaagcgcaagccactcttctacaccatcaatctgatcatc
ccttgtgtgctcatcacgtcgctggctatcctggtcttctacctgccctccgactgtggg
gagaagatgacgctctgcatctcagtgctgctggcactcacattcttcctgctgctcatc
tccaagatcgtgcctcccacctcccttgacattcccctcattggcaagtacctcttgttc
accatggtgctggtcaccttttccatcgtcaccactgtgtgtgtcctcaatgtgcaccac
cgttcacccagcactcacaccatggcatcctgggtcaaggagtgcttcctgcacaagctg
cccaccttcctcttcatgaagcgccctggtctggaagtcagccccgccagggtccctcat
tccagccagctgcacttgaccacagctgaagctacgtccacctctgccttaggccccagc
agcccatccaacctctatgggaattccatgtactttgtgaaccctgtccctgccactcct
aagtctgcagtcagctcccacacggcaggcctccccagggatgcccggctgaggtcctct
gggaggttccggcaagatctacaggaagcattagagggcgtcagcttcatcgcacagcat
ttggagagtgatgatcgagatcagagtgtcatcgaggactggaaattcgtcgcaatggtc
gtcgaccgcctgttcctgtgggtgttcgtgattgtgtgtattctgggcaccatggggctc
ttcctgccacccctcttccagatccacgcaccctccaagggcctctag

DBGET integrated database retrieval system