KEGG   Mus musculus (mouse): 108017
Entry
108017            CDS       T01002                                 

Gene name
Fxyd4, 0610008I02Rik, AI267073, Chi, Chif
Definition
(RefSeq) FXYD domain-containing ion transport regulator 4
  KO
K13359  FXYD domain containing ion transport regulator 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108017 (Fxyd4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    108017 (Fxyd4)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   108017 (Fxyd4)
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8 Phage_holin_3_6
Other DBs
NCBI-GeneID: 108017
NCBI-ProteinID: NP_001166843
MGI: 1889005
Ensembl: ENSMUSG00000004988
Vega: OTTMUSG00000056757
UniProt: Q9D2W0
Position
6; 6 F1
AA seq 88 aa
MEEITCAFLLLLAGLPALEASDPVDKDSPFYYDWESLQLGGLIFGGLLCIAGIAMALSGK
CKCRRTHKPSSLPGKATPLIIPGSANTC
NT seq 267 nt   +upstreamnt  +downstreamnt
atggaggaaatcacctgtgcctttctcctgctgctagcaggtctgccggccttggaagcc
agtgacccagttgataaagacagtcccttctactatgactgggagagcctgcagctggga
ggattgatttttggagggctcctgtgcatcgctggaattgccatggccctgagtggcaag
tgcaaatgtaggcgtacccataagcccagttccttacctggaaaagccactccactcatc
attccaggctctgccaatacctgctga

DBGET integrated database retrieval system