KEGG   Mus musculus (mouse): 108043
Entry
108043            CDS       T01002                                 

Gene name
Chrnb3, 5730417K16Rik, Acrb3
Definition
(RefSeq) cholinergic receptor, nicotinic, beta polypeptide 3
  KO
K04814  nicotinic acetylcholine receptor beta-3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108043 (Chrnb3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    108043 (Chrnb3)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   108043 (Chrnb3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 108043
NCBI-ProteinID: NP_775304
MGI: 106212
Ensembl: ENSMUSG00000031492
Vega: OTTMUSG00000061035
UniProt: Q8BMN3 Q3UZS0
Position
8; 8 A2
AA seq 464 aa
MTGFLRVFLALSATLSGSWVTLTATAGLSSVAEHEDALLRHLFQGYQKCVRPVLNSSDII
KVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDQKLRWNPEDYGGINSIKVPSESLWLPD
IVLFENADGRFEGSLMTKAIVKSSGTVSWTPPASYKSSCTMDVTFFPFDKQNCSMKFGSW
TYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRREGFYSYPFVTYSFVLRRLPL
FYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIP
LIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLEKLPRWLCMKDPRD
RFSFPDGTESKGTVRGKFPGKKKQTPTSDGERVLVAFLEKASESIRYISRHVKKEHFISQ
VVQDWKFVAQVLDRIFLWLFLTASVLGSVLIFIPALKMWIHRFH
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgacaggcttcctacgggtcttcttggctctcagtgccactctctcaggttcctgggtg
actctcacagccactgcgggactcagctcagtggctgaacatgaagacgcactcctcaga
catttgttccaaggttatcagaaatgtgtccgccctgtgttgaattccagtgacatcata
aaagtgtattttggattaaagatatctcagcttgtagatgtggatgaaaagaatcagctg
atgacaacaaacgtgtggctgaagcaggaatggacagaccaaaaattacgatggaatccc
gaagactatggtggaattaattcgataaaggttccatcggagtcgctctggctgcctgac
atagttctctttgaaaatgctgacggacgttttgagggctctctcatgaccaaggccatt
gtgaaatccagcggaaccgtcagttggactcctcccgccagctacaaaagttcctgtacc
atggatgtcacatttttcccgttcgataagcagaactgctcaatgaagttcggatcctgg
acttacgatggtaccatggtcgacctcattctgatcaatgaaaacgttgaccggaaagac
ttttttgataacggagagtgggagatactaaatgcaaaggggatgaagggcaacagaaga
gaaggcttttactcctatccgtttgttacctactcttttgttctgagacgcctgcccctg
ttttacaccctctttttgataatcccctgcctggggctgtcttttctcacggtcctggtg
ttctacctaccctccgacgaaggggaaaaactctccttatccacctcggttttggtttct
ttgacagtgtttcttttagtaatcgaagaaataatcccgtcttcttcaaaagtcatccct
ctcattggggagtacctcctcttcattatgatatttgtcacgctgtctattattgtcacg
gtttttgtaattaatgtccaccacagatcttcctcaacgtaccatcccatggccccctgg
gtgaagaggctgtttctggaaaaactcccgagatggctttgcatgaaggaccccagggac
cgcttctctttccccgatggaacggagagtaagggaaccgtgagggggaaatttccaggg
aaaaagaagcagactcctaccagtgatggagaaagagttctggtcgctttcctggagaag
gcctctgagtccatcagatacatctcgaggcatgtgaagaaggaacacttcatcagtcag
gttgttcaagactggaaattcgtggctcaggttcttgaccgcatcttcctctggctcttt
ctgacagcttcggttttgggctctgtcctgatttttattccagccttgaagatgtggata
catcgtttccattag

DBGET integrated database retrieval system