KEGG   Mus musculus (mouse): 108058
Entry
108058            CDS       T01002                                 

Gene name
Camk2d, 2810011D23Rik, 8030469K03Rik, CaMK_II, [d]-CaMKII
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase II, delta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04114  Oocyte meiosis
mmu04217  Necroptosis
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04740  Olfactory transduction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04916  Melanogenesis
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04934  Cushing syndrome
mmu04971  Gastric acid secretion
mmu05012  Parkinson disease
mmu05031  Amphetamine addiction
mmu05152  Tuberculosis
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05214  Glioma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108058 (Camk2d)
   04310 Wnt signaling pathway
    108058 (Camk2d)
   04066 HIF-1 signaling pathway
    108058 (Camk2d)
   04020 Calcium signaling pathway
    108058 (Camk2d)
   04024 cAMP signaling pathway
    108058 (Camk2d)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108058 (Camk2d)
   04217 Necroptosis
    108058 (Camk2d)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    108058 (Camk2d)
   04922 Glucagon signaling pathway
    108058 (Camk2d)
   04912 GnRH signaling pathway
    108058 (Camk2d)
   04921 Oxytocin signaling pathway
    108058 (Camk2d)
   04916 Melanogenesis
    108058 (Camk2d)
   04925 Aldosterone synthesis and secretion
    108058 (Camk2d)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108058 (Camk2d)
  09154 Digestive system
   04971 Gastric acid secretion
    108058 (Camk2d)
  09156 Nervous system
   04725 Cholinergic synapse
    108058 (Camk2d)
   04728 Dopaminergic synapse
    108058 (Camk2d)
   04720 Long-term potentiation
    108058 (Camk2d)
   04722 Neurotrophin signaling pathway
    108058 (Camk2d)
  09157 Sensory system
   04740 Olfactory transduction
    108058 (Camk2d)
   04750 Inflammatory mediator regulation of TRP channels
    108058 (Camk2d)
  09158 Development and regeneration
   04360 Axon guidance
    108058 (Camk2d)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108058 (Camk2d)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108058 (Camk2d)
   05205 Proteoglycans in cancer
    108058 (Camk2d)
  09162 Cancer: specific types
   05214 Glioma
    108058 (Camk2d)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108058 (Camk2d)
  09165 Substance dependence
   05031 Amphetamine addiction
    108058 (Camk2d)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108058 (Camk2d)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108058 (Camk2d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    108058 (Camk2d)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108058 (Camk2d)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   108058 (Camk2d)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_2 SnoaL_4 DUF4915
Other DBs
NCBI-GeneID: 108058
NCBI-ProteinID: NP_001020609
MGI: 1341265
Ensembl: ENSMUSG00000053819
Vega: OTTMUSG00000023550
UniProt: Q6PHZ2
Structure
PDB: 
6BAB

Position
3; 3 G1
AA seq 499 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEA
INNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH
LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPP
CIPNGKENFSGGTSLWQNI
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcttcgaccaccacctgcacccggttcaccgacgagtatcagctctttgaggagctc
ggaaagggggcgttctcagtggtgagaagatgtatgaaaatccctactggacaagagtat
gctgccaaaattatcaacaccaaaaagctttctgctagggaccatcagaaactggaaagg
gaagctagaatctgccgtctcttgaagcaccccaatattgtgagacttcacgacagtata
tcggaggagggcttccattacttggtgtttgacttagtgactggtggcgaactgtttgaa
gacatagtggcaagagaatattacagtgaagctgatgccagtcattgtatacaacagatt
ctagagagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaagtccaaaggagcagctgtgaagctggcagacttcggctta
gccatagaagttcaaggcgaccagcaggcatggtttggttttgctggcacacctgggtat
ctttctccagaagtcctgcgtaaagatccttatggaaaaccagtggatatgtgggcatgc
ggtgtcatcctctacatcttgctggtgggatacccacccttctgggatgaagatcagcat
agactgtatcagcagatcaaggccggagcttacgattttccgtcaccagaatgggataca
gtgacacctgaagccaaagacctcatcaacaaaatgctgaccatcaaccctgccaaacgt
atcacagcctctgaggccctgaaacacccatggatctgtcaacgctctactgttgcctcc
atgatgcacaggcaggagactgtagactgcttgaagaaatttaatgctagacggaaactg
aagggcgccatcttgacaactatgctggctacgagaaatttttcagcagccaagagttta
ttgaagaaaccagatggggtaaaggagtcaactgagagctcaaacaccaccattgaggat
gaagacgtgaaagcacgaaaacaggagatcatcaaagtcactgagcaactgattgaagct
atcaacaatggggactttgaggcttacacaaaaatctgtgatccaggcctcactgccttt
gaacctgaagcattgggcaacttagtggaagggatggactttcacagattctactttgaa
aatgctttgtccaaaagcaataaaccaatccacacgatcatcctcaacccacacgttcac
ctggtaggggatgacgcagcctgcatcgcatacattcggctcacacagtacatggacgga
agcgggatgccaaagaccatgcagtcagaagagacgcgcgtgtggcaccgccgtgatggg
aagtggcagaatgttcactttcaccgttcggggtcccccacagtacccatcaagccaccc
tgtattccaaatgggaaagagaacttctcaggaggcacctctttgtggcaaaacatctga

DBGET integrated database retrieval system