KEGG   Mus musculus (mouse): 108058
Entry
108058            CDS       T01002                                 

Gene name
Camk2d, 2810011D23Rik, 8030469K03Rik, CaMK_II, [d]-CaMKII
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase II, delta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04114  Oocyte meiosis
mmu04217  Necroptosis
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04740  Olfactory transduction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04916  Melanogenesis
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04934  Cushing syndrome
mmu04971  Gastric acid secretion
mmu05012  Parkinson disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05031  Amphetamine addiction
mmu05152  Tuberculosis
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05214  Glioma
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108058 (Camk2d)
   04310 Wnt signaling pathway
    108058 (Camk2d)
   04066 HIF-1 signaling pathway
    108058 (Camk2d)
   04020 Calcium signaling pathway
    108058 (Camk2d)
   04024 cAMP signaling pathway
    108058 (Camk2d)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108058 (Camk2d)
   04217 Necroptosis
    108058 (Camk2d)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    108058 (Camk2d)
   04922 Glucagon signaling pathway
    108058 (Camk2d)
   04912 GnRH signaling pathway
    108058 (Camk2d)
   04921 Oxytocin signaling pathway
    108058 (Camk2d)
   04916 Melanogenesis
    108058 (Camk2d)
   04925 Aldosterone synthesis and secretion
    108058 (Camk2d)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108058 (Camk2d)
  09154 Digestive system
   04971 Gastric acid secretion
    108058 (Camk2d)
  09156 Nervous system
   04725 Cholinergic synapse
    108058 (Camk2d)
   04728 Dopaminergic synapse
    108058 (Camk2d)
   04720 Long-term potentiation
    108058 (Camk2d)
   04722 Neurotrophin signaling pathway
    108058 (Camk2d)
  09157 Sensory system
   04740 Olfactory transduction
    108058 (Camk2d)
   04750 Inflammatory mediator regulation of TRP channels
    108058 (Camk2d)
  09158 Development and regeneration
   04360 Axon guidance
    108058 (Camk2d)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108058 (Camk2d)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108058 (Camk2d)
   05205 Proteoglycans in cancer
    108058 (Camk2d)
  09162 Cancer: specific types
   05214 Glioma
    108058 (Camk2d)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108058 (Camk2d)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108058 (Camk2d)
   05022 Pathways of neurodegeneration - multiple diseases
    108058 (Camk2d)
  09165 Substance dependence
   05031 Amphetamine addiction
    108058 (Camk2d)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    108058 (Camk2d)
   05415 Diabetic cardiomyopathy
    108058 (Camk2d)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108058 (Camk2d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    108058 (Camk2d)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108058 (Camk2d)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   108058 (Camk2d)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_2 SnoaL_4 DUF4915
Other DBs
NCBI-GeneID: 108058
NCBI-ProteinID: NP_001020609
MGI: 1341265
Ensembl: ENSMUSG00000053819
Vega: OTTMUSG00000023550
UniProt: Q6PHZ2
Structure
PDB: 
6BAB

Position
3; 3 G1- G2
AA seq 499 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEA
INNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH
LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPP
CIPNGKENFSGGTSLWQNI
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcttcgaccaccacctgcacccggttcaccgacgagtatcagctctttgaggagctc
ggaaagggggcgttctcagtggtgagaagatgtatgaaaatccctactggacaagagtat
gctgccaaaattatcaacaccaaaaagctttctgctagggaccatcagaaactggaaagg
gaagctagaatctgccgtctcttgaagcaccccaatattgtgagacttcacgacagtata
tcggaggagggcttccattacttggtgtttgacttagtgactggtggcgaactgtttgaa
gacatagtggcaagagaatattacagtgaagctgatgccagtcattgtatacaacagatt
ctagagagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaagtccaaaggagcagctgtgaagctggcagacttcggctta
gccatagaagttcaaggcgaccagcaggcatggtttggttttgctggcacacctgggtat
ctttctccagaagtcctgcgtaaagatccttatggaaaaccagtggatatgtgggcatgc
ggtgtcatcctctacatcttgctggtgggatacccacccttctgggatgaagatcagcat
agactgtatcagcagatcaaggccggagcttacgattttccgtcaccagaatgggataca
gtgacacctgaagccaaagacctcatcaacaaaatgctgaccatcaaccctgccaaacgt
atcacagcctctgaggccctgaaacacccatggatctgtcaacgctctactgttgcctcc
atgatgcacaggcaggagactgtagactgcttgaagaaatttaatgctagacggaaactg
aagggcgccatcttgacaactatgctggctacgagaaatttttcagcagccaagagttta
ttgaagaaaccagatggggtaaaggagtcaactgagagctcaaacaccaccattgaggat
gaagacgtgaaagcacgaaaacaggagatcatcaaagtcactgagcaactgattgaagct
atcaacaatggggactttgaggcttacacaaaaatctgtgatccaggcctcactgccttt
gaacctgaagcattgggcaacttagtggaagggatggactttcacagattctactttgaa
aatgctttgtccaaaagcaataaaccaatccacacgatcatcctcaacccacacgttcac
ctggtaggggatgacgcagcctgcatcgcatacattcggctcacacagtacatggacgga
agcgggatgccaaagaccatgcagtcagaagagacgcgcgtgtggcaccgccgtgatggg
aagtggcagaatgttcactttcaccgttcggggtcccccacagtacccatcaagccaccc
tgtattccaaatgggaaagagaacttctcaggaggcacctctttgtggcaaaacatctga

KEGG   Mus musculus (mouse): 12322
Entry
12322             CDS       T01002                                 

Gene name
Camk2a, CaMKII, R74975, mKIAA0968
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase II alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04114  Oocyte meiosis
mmu04217  Necroptosis
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04740  Olfactory transduction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04916  Melanogenesis
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04934  Cushing syndrome
mmu04971  Gastric acid secretion
mmu05012  Parkinson disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05031  Amphetamine addiction
mmu05152  Tuberculosis
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05214  Glioma
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    12322 (Camk2a)
   04310 Wnt signaling pathway
    12322 (Camk2a)
   04066 HIF-1 signaling pathway
    12322 (Camk2a)
   04020 Calcium signaling pathway
    12322 (Camk2a)
   04024 cAMP signaling pathway
    12322 (Camk2a)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    12322 (Camk2a)
   04217 Necroptosis
    12322 (Camk2a)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    12322 (Camk2a)
   04922 Glucagon signaling pathway
    12322 (Camk2a)
   04912 GnRH signaling pathway
    12322 (Camk2a)
   04921 Oxytocin signaling pathway
    12322 (Camk2a)
   04916 Melanogenesis
    12322 (Camk2a)
   04925 Aldosterone synthesis and secretion
    12322 (Camk2a)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    12322 (Camk2a)
  09154 Digestive system
   04971 Gastric acid secretion
    12322 (Camk2a)
  09156 Nervous system
   04725 Cholinergic synapse
    12322 (Camk2a)
   04728 Dopaminergic synapse
    12322 (Camk2a)
   04720 Long-term potentiation
    12322 (Camk2a)
   04722 Neurotrophin signaling pathway
    12322 (Camk2a)
  09157 Sensory system
   04740 Olfactory transduction
    12322 (Camk2a)
   04750 Inflammatory mediator regulation of TRP channels
    12322 (Camk2a)
  09158 Development and regeneration
   04360 Axon guidance
    12322 (Camk2a)
  09159 Environmental adaptation
   04713 Circadian entrainment
    12322 (Camk2a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12322 (Camk2a)
   05205 Proteoglycans in cancer
    12322 (Camk2a)
  09162 Cancer: specific types
   05214 Glioma
    12322 (Camk2a)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    12322 (Camk2a)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    12322 (Camk2a)
   05022 Pathways of neurodegeneration - multiple diseases
    12322 (Camk2a)
  09165 Substance dependence
   05031 Amphetamine addiction
    12322 (Camk2a)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    12322 (Camk2a)
   05415 Diabetic cardiomyopathy
    12322 (Camk2a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12322 (Camk2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12322 (Camk2a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     12322 (Camk2a)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   12322 (Camk2a)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Kdo Pkinase_fungal SnoaL_2 SnoaL_4 TCAD9
Other DBs
NCBI-GeneID: 12322
NCBI-ProteinID: NP_803126
MGI: 88256
Ensembl: ENSMUSG00000024617
Vega: OTTMUSG00000016302
UniProt: P11798
Structure
PDB: 
1HKX

Position
18 E1; 18 34.41 cM
AA seq 478 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggctaccatcacctgcacccgattcacagaagagtaccagctctttgaggaactggga
aagggagccttctctgtggtgcgcaggtgtgtgaaggtgctggctggtcaggagtatgct
gccaagattatcaacaccaagaagctttcagccagagatcaccagaagctggagcgtgag
gcccgcatctgccgcttgttgaagcaccccaatatcgtccgactccatgacagcatctcc
gaggaggggcaccactaccttatcttcgatctggttactggtggggaactgtttgaagac
attgtggcccgggagtattacagtgaagctgatgccagccactgtatccagcagatcttg
gaggctgtgctacactgtcaccagatgggggtggtgcatcgtgacctgaagcctgagaat
ctgttgctggcctcgaagctcaagggcgctgctgtgaagctggcagactttggcctggcc
atagaggtggagggggagcagcaggcatggtttgggttcgcagggacacctggatacctc
tccccagaagtgctgaggaaggacccgtacgggaagcccgtggacctgtgggcctgtggc
gtcatcctgtatatcttgctggttgggtatcccccgttctgggatgaagaccagcatcgc
ctgtaccagcagatcaaagctggtgcctatgatttcccatcaccagaatgggacaccgtc
accccagaagccaaggatctgatcaataagatgctgaccatcaacccgtccaaacgcatc
acggccgctgaggctctcaagcacccatggatctcgcaccgctccaccgtggcctcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaatgccaggaggaaactgaag
ggagccatcctcaccactatgctggccaccaggaacttctccggagggaagagcggagga
aacaagaagaacgatggtgtgaaggaatcttctgagagcaccaacaccaccattgaggac
gaagacaccaaagtgcgcaaacaggaaattatcaaagtgacagagcagctgatcgaagcc
ataagcaatggagactttgagtcctacacgaagatgtgcgaccctggaatgacagccttt
gaaccagaggccctggggaacctggtggagggcctggactttcatcgattctattttgaa
aacctgtggtcccggaacagcaagcccgtgcacaccaccatcctgaaccctcacatccac
ctgatgggtgacgagtcagcctgcatcgcctatatccgcatcactcagtacctggatgca
ggcggcataccccgcacggcccagtcagaggagacccgcgtctggcaccgcagggacggc
aaatggcagatcgtccacttccacagatctggggcgccctccgtcctgccgcattga

KEGG   Mus musculus (mouse): 12323
Entry
12323             CDS       T01002                                 

Gene name
Camk2b, CaMKII
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase II, beta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04114  Oocyte meiosis
mmu04217  Necroptosis
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04740  Olfactory transduction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04916  Melanogenesis
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04934  Cushing syndrome
mmu04971  Gastric acid secretion
mmu05012  Parkinson disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05031  Amphetamine addiction
mmu05152  Tuberculosis
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05214  Glioma
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    12323 (Camk2b)
   04310 Wnt signaling pathway
    12323 (Camk2b)
   04066 HIF-1 signaling pathway
    12323 (Camk2b)
   04020 Calcium signaling pathway
    12323 (Camk2b)
   04024 cAMP signaling pathway
    12323 (Camk2b)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    12323 (Camk2b)
   04217 Necroptosis
    12323 (Camk2b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    12323 (Camk2b)
   04922 Glucagon signaling pathway
    12323 (Camk2b)
   04912 GnRH signaling pathway
    12323 (Camk2b)
   04921 Oxytocin signaling pathway
    12323 (Camk2b)
   04916 Melanogenesis
    12323 (Camk2b)
   04925 Aldosterone synthesis and secretion
    12323 (Camk2b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    12323 (Camk2b)
  09154 Digestive system
   04971 Gastric acid secretion
    12323 (Camk2b)
  09156 Nervous system
   04725 Cholinergic synapse
    12323 (Camk2b)
   04728 Dopaminergic synapse
    12323 (Camk2b)
   04720 Long-term potentiation
    12323 (Camk2b)
   04722 Neurotrophin signaling pathway
    12323 (Camk2b)
  09157 Sensory system
   04740 Olfactory transduction
    12323 (Camk2b)
   04750 Inflammatory mediator regulation of TRP channels
    12323 (Camk2b)
  09158 Development and regeneration
   04360 Axon guidance
    12323 (Camk2b)
  09159 Environmental adaptation
   04713 Circadian entrainment
    12323 (Camk2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12323 (Camk2b)
   05205 Proteoglycans in cancer
    12323 (Camk2b)
  09162 Cancer: specific types
   05214 Glioma
    12323 (Camk2b)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    12323 (Camk2b)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    12323 (Camk2b)
   05022 Pathways of neurodegeneration - multiple diseases
    12323 (Camk2b)
  09165 Substance dependence
   05031 Amphetamine addiction
    12323 (Camk2b)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    12323 (Camk2b)
   05415 Diabetic cardiomyopathy
    12323 (Camk2b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12323 (Camk2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12323 (Camk2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     12323 (Camk2b)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   12323 (Camk2b)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH SnoaL_2 Pkinase_fungal Kdo SnoaL_4 TCAD9
Other DBs
NCBI-GeneID: 12323
NCBI-ProteinID: NP_031621
MGI: 88257
Ensembl: ENSMUSG00000057897
Vega: OTTMUSG00000005105
UniProt: P28652 Q8BL41
Position
11 A1; 11 3.89 cM
AA seq 542 aa
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSSAITSPKGSLPPAALEPQTTVIHNPVDGIKESSDSTNTTIEDEDAKARKQEIIKTTEQ
LIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILN
PHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAP
LQ
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggccaccacggtgacctgcacccgtttcaccgacgagtaccagctatacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgtaccggccatgagtat
gcagccaagatcattaataccaagaagctgtcggccagagatcaccagaaactggagaga
gaagctcggatctgccgcctgctgaagcattccaacattgtacgcctccatgacagcatc
tctgaagagggcttccactacctggtcttcgatctggtcactggtggggagctctttgaa
gacatcgtggcaagagagtactacagtgaagctgatgccagtcactgcatccagcagatc
ctggaagctgttctccattgtcaccaaatgggggtcgtccacagagacctcaagcctgag
aacctgcttctggccagcaaatgcaaaggcgccgcagtgaagctggcagacttcggcctg
gccatcgaggttcagggagaccagcaggcatggtttggatttgcgggaacgccaggctac
ctgtctcccgaggtccttcggaaggaggcctacggcaaacctgtggacatctgggcatgt
ggggtgatcctgtatatcctgctggtgggctacccacctttctgggatgaggaccaacac
aagctgtaccagcagatcaaggctggggcgtatgatttcccatcccctgagtgggacacc
gttactcctgaagccaaaaacctcatcaaccagatgctgaccatcaaccctgccaagcgc
atcacggcccatgaggccctgaagcacccatgggtctgccaacgttccaccgtggcctct
atgatgcacagacaggagactgtggaatgtctgaagaagttcaatgcaaggaggaagctc
aagggagccatcctcaccactatgctggccacacggaatttctcagtgggcagacagacc
accgctccggccacaatgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gccaagagtttactcaacaagaaagcagatggagtcaagccccagacaaacagcaccaaa
aacagctcggccatcaccagccccaaaggatctctccctcctgctgccctggagcctcaa
accaccgttatccataacccagtggacgggattaaggaatcttccgacagcaccaacaca
accatagaggatgaagatgccaaagcccggaagcaggaaatcatcaagaccacagagcag
ctcattgaggccgtcaacaatggggactttgaggcctatgcgaaaatctgtgacccaggc
ctgacctcatttgagcctgaagctctgggcaacctggtcgaagggatggatttccacaga
ttctactttgagaacctgctggccaagaacagcaagccgatccacaccaccatcctgaac
ccgcacgtgcacgtcattggcgaggatgcggcatgcatcgcctacatccgcctcacacag
tacatcgatggccagggcagaccccgtaccagccagtccgaagagacccgtgtgtggcac
cgccgcgacggcaagtggcagaatgtacatttccactgctcgggcgctccagtggccccg
ctgcagtga

KEGG   Mus musculus (mouse): 12325
Entry
12325             CDS       T01002                                 

Gene name
Camk2g, Camk, Camkg
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase II gamma
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04114  Oocyte meiosis
mmu04217  Necroptosis
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04740  Olfactory transduction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04916  Melanogenesis
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04934  Cushing syndrome
mmu04971  Gastric acid secretion
mmu05012  Parkinson disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05031  Amphetamine addiction
mmu05152  Tuberculosis
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05214  Glioma
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    12325 (Camk2g)
   04310 Wnt signaling pathway
    12325 (Camk2g)
   04066 HIF-1 signaling pathway
    12325 (Camk2g)
   04020 Calcium signaling pathway
    12325 (Camk2g)
   04024 cAMP signaling pathway
    12325 (Camk2g)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    12325 (Camk2g)
   04217 Necroptosis
    12325 (Camk2g)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    12325 (Camk2g)
   04922 Glucagon signaling pathway
    12325 (Camk2g)
   04912 GnRH signaling pathway
    12325 (Camk2g)
   04921 Oxytocin signaling pathway
    12325 (Camk2g)
   04916 Melanogenesis
    12325 (Camk2g)
   04925 Aldosterone synthesis and secretion
    12325 (Camk2g)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    12325 (Camk2g)
  09154 Digestive system
   04971 Gastric acid secretion
    12325 (Camk2g)
  09156 Nervous system
   04725 Cholinergic synapse
    12325 (Camk2g)
   04728 Dopaminergic synapse
    12325 (Camk2g)
   04720 Long-term potentiation
    12325 (Camk2g)
   04722 Neurotrophin signaling pathway
    12325 (Camk2g)
  09157 Sensory system
   04740 Olfactory transduction
    12325 (Camk2g)
   04750 Inflammatory mediator regulation of TRP channels
    12325 (Camk2g)
  09158 Development and regeneration
   04360 Axon guidance
    12325 (Camk2g)
  09159 Environmental adaptation
   04713 Circadian entrainment
    12325 (Camk2g)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12325 (Camk2g)
   05205 Proteoglycans in cancer
    12325 (Camk2g)
  09162 Cancer: specific types
   05214 Glioma
    12325 (Camk2g)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    12325 (Camk2g)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    12325 (Camk2g)
   05022 Pathways of neurodegeneration - multiple diseases
    12325 (Camk2g)
  09165 Substance dependence
   05031 Amphetamine addiction
    12325 (Camk2g)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    12325 (Camk2g)
   05415 Diabetic cardiomyopathy
    12325 (Camk2g)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12325 (Camk2g)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12325 (Camk2g)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     12325 (Camk2g)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   12325 (Camk2g)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Pkinase_fungal Kdo SnoaL_2 ABC1 RIO1
Other DBs
NCBI-GeneID: 12325
NCBI-ProteinID: NP_848712
MGI: 88259
Ensembl: ENSMUSG00000021820
UniProt: Q923T9 Q6ZWS7 Q8BW40
Position
14; 14 A3
AA seq 529 aa
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSLVSPAQEPAPL
QTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAINNGDFEAY
TKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACI
AYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggccaccaccgccacctgcacccgcttcaccgacgactaccagcttttcgaggagctc
ggcaagggtgccttctcagtggtccggaggtgtgtaaagaaaacatctacgcaggaatat
gctgcaaaaatcatcaataccaagaagttgtccgcccgagatcatcagaaactagaacga
gaggcccggatatgccgacttctgaaacatccaaacattgtgcgtctccatgacagtatt
tctgaagaagggtttcactacctcgtgtttgaccttgttaccggaggggagttgtttgaa
gacattgtggccagagagtactacagtgaagctgatgccagccactgtatacatcagatc
ctggagagtgttaaccacatccaccagcatgacatcgtccaccgggatctgaagcctgag
aacttgctgctggcgagtaaatgcaagggtgctgcggtcaagctagctgattttggcctg
gccatcgaagtacagggagagcagcaggcttggtttggttttgccggcaccccaggttac
ttgtcccctgaggtcttgaggaaagatccctatggaaaacctgtggacatctgggcctgc
ggggtcatcctgtatatcctcctggtgggctaccctcccttctgggatgaggatcagcac
aagctgtatcagcagatcaaagctggagcctacgatttcccatcaccagaatgggacaca
gtcactcctgaagctaagaacttgatcaaccagatgctgaccataaaccctgcaaagcgc
atcacggccgaccaggctctcaagcacccatgggtctgtcaacggtctacggtggcatcc
atgatgcatcgccaagagacggtagagtgcttacgcaaattcaacgcccggagaaaactg
aagggtgccatcctcacaaccatgcttgtctccaggaacttttcagctgccaaaagccta
ttgaacaagaagtcagatggcggtgtcaagaaaaggaagtcgagttccagcgtgcaccta
atgccacagagcaacaacaaaaacagtctcgtaagcccagcccaagagcctgcgcccttg
cagacggccatggaaccacaaaccaccgtggtacataatgctacagatgggatcaagggc
tccacagagagctgtaacaccactacagaagacgaagatctcaaagtgagaaaacaagaa
atcattaagatcacagaacaactgatcgaagccatcaacaatggggactttgaggcctac
acgaagatttgtgacccgggcctcacatcctttgagccagaagcccttggtaacctcgtg
gaaggaatggatttccataagttttactttgagaatctcctgtccaagaacagcaagcct
atccacaccaccatcctaaaccctcacgtccacgtgattggggaggacgcagcttgcatc
gcctatatccggctcactcagtacatcgacgggcagggtcggcctcgcaccagtcagtca
gaggagacccgggtgtggcaccgccgggatggcaagtggctcaatgtccactatcactgc
tcaggggcccctgccgcaccgctacagtga

KEGG   Mus musculus (mouse): 12326
Entry
12326             CDS       T01002                                 

Gene name
Camk4, A430110E23Rik, AI666733, CaM, CaMKI, CaMKIV, CaMKIV/Gr, D18Bwg0362e
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04211  Longevity regulating pathway
mmu04371  Apelin signaling pathway
mmu04380  Osteoclast differentiation
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04921  Oxytocin signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05214  Glioma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    12326 (Camk4)
   04020 Calcium signaling pathway
    12326 (Camk4)
   04024 cAMP signaling pathway
    12326 (Camk4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    12326 (Camk4)
   04925 Aldosterone synthesis and secretion
    12326 (Camk4)
  09156 Nervous system
   04725 Cholinergic synapse
    12326 (Camk4)
   04720 Long-term potentiation
    12326 (Camk4)
   04722 Neurotrophin signaling pathway
    12326 (Camk4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    12326 (Camk4)
  09149 Aging
   04211 Longevity regulating pathway
    12326 (Camk4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    12326 (Camk4)
  09165 Substance dependence
   05031 Amphetamine addiction
    12326 (Camk4)
   05034 Alcoholism
    12326 (Camk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12326 (Camk4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     12326 (Camk4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   12326 (Camk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Kdo YrbL-PhoP_reg APH DUF4122
Other DBs
NCBI-GeneID: 12326
NCBI-ProteinID: NP_033923
MGI: 88258
Ensembl: ENSMUSG00000038128
UniProt: Q8BGR3
Position
18 B1; 18 18.15 cM
AA seq 469 aa
MLKVTVPSCPSSPCSSVTASTENLVPDYWIDGSNRDPLGDFFEVESELGRGATSIVYRCK
QKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGG
ELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIA
DFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDE
RGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKRLTTFQALQHPWVTGKA
ANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHTSIQENHKASSDPPSTQD
AKDSTDLLGKKMQEEDQEEDQVEAEASADEMRKLQSEEVEKDAGVKEEETSSMVPQDPED
ELETDDPEMKRDSEEKLKSVEEEMDPMTEEEAPDAGLGVPQQDAIQPEY
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcctgtccctcctcgccctgctcctcggtcaccgccagt
actgagaacctcgtcccggattactggatcgacggctctaaccgagatcctctgggcgat
ttcttcgaggtggagtcagagctgggacggggtgctacatccattgtgtacagatgcaaa
cagaaggggacccagaagccctatgctctcaaagtgttaaagaaaacagtggacaagaag
attgtgagaacagaaataggagttctcctgcgtctctcacacccgaacatcataaaactc
aaggaaatattcgaaacccccacagaaatcagcctggtccttgagctggtcacaggagga
gaactgtttgacaggattgtggagaagggatactacagtgagcgcgatgcggctgacgcg
gtgaagcagatcctggaggccgttgcttacctgcatgaaaatgggattgtccatcgtgac
ctcaaaccagagaatcttctttatgcaactccagcccctgatgcacccctcaaaattgct
gattttggactttcaaaaattgtggaacatcaagtgctcatgaagacagtgtgtggaacc
ccggggtactgcgcacctgagattctccgaggctgtgcctacggacctgaggtggacatg
tggtctgtaggaataatcacctacatcctactttgtggatttgaaccattctatgacgag
cgaggtgatcagttcatgttcaggagaattctgaattgtgaatattactttatctccccc
tggtgggatgaagtgtctttaaatgccaaggacttggtcaaaaagctcattgttttggat
cccaagaaacggctgactacatttcaagccctccaacacccatgggtcacaggtaaagcg
gccaactttgttcacatggacactgctcagaagaaacttcaagaattcaatgctcggcgc
aagcttaaggcagcggtgaaggctgtggtggcctcttctcggctgggaagtgccagcagt
agccacaccagcatccaagagaaccacaaggccagctcggatccaccttcaacccaagat
gccaaggacagcacagatcttctgggaaagaaaatgcaagaggaggaccaagaggaggac
caagtggaggccgaggcttcagccgatgagatgaggaagctgcagtccgaggaggtggag
aaagatgcaggtgtaaaagaggaggagacctccagtatggtgcctcaggatccagaggat
gagctggaaacagatgacccagagatgaagagggattcagaggagaagctgaagagtgtg
gaggaagaaatggaccccatgactgaggaggaagcccctgacgcgggacttggggttcca
cagcaggatgcgattcagccagagtactaa

KEGG   Mus musculus (mouse): 215303
Entry
215303            CDS       T01002                                 

Gene name
Camk1g, CLIC, CLICK-III, CaMKIgamma
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase I gamma
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu05214  Glioma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    215303 (Camk1g)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    215303 (Camk1g)
   04925 Aldosterone synthesis and secretion
    215303 (Camk1g)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    215303 (Camk1g)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    215303 (Camk1g)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     215303 (Camk1g)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   215303 (Camk1g)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Kdo APH RIO1 Pkinase_fungal DUF5898 CoV_S2_C 5_nucleotid YrbL-PhoP_reg CsgA
Other DBs
NCBI-GeneID: 215303
NCBI-ProteinID: NP_659066
MGI: 2388073
Ensembl: ENSMUSG00000016179
Vega: OTTMUSG00000035816
UniProt: Q91VB2
Position
1 H6; 1 97.74 cM
AA seq 477 aa
MGRKEEEDCSSWKKQTTNIRKTFIFMEVLGSGAFSEVFLVKQRVTGKLFALKCIKKSPAF
RDSSLENEIAVLKRIKHENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDA
SLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEENSKIMITDFGLSKMEQNGVMSTAC
GTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFYEETESKLFEKIKEGYYEFES
PFWDDISESAKDFICHLLEKDPNERYTCEKALRHPWIDGNTALHRDIYPSVSLQIQKNFA
KSKWRQAFNAAAVVHHMRKLHMNLHSPSVRQEVENRPPVSPAPEVSRPDSHDSSITEAPI
LDPSTPLPALTRLPCSHSSRPSAPSGGRSLNCLVNGSLRISSSLVPMQQGPLATGPCGCC
SSCLNIGNKGKSSYCSEPTLFRKANKKQNFKSEVMVPVKAGGSTHCRGGQTGVCLVM
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggggcgtaaggaggaggaggactgcagttcctggaagaaacagaccaccaacatcagg
aaaaccttcatcttcatggaagtgctgggatcaggagctttctcagaggtgttcctggtg
aagcaaagagtgactgggaaactctttgctctgaaatgtatcaagaagtcaccagccttc
cgggacagcagcctagagaatgagatcgctgtgttgaaaaggatcaagcatgagaacatt
gtgaccctggaggacatctatgagagcaccacccactactacctggtcatgcagcttgtt
tctggaggtgagctttttgaccggatcctagagcgtggtgtctacacagaaaaggatgcc
agcctggtcatccagcaggtcttgtctgcggtgaaataccttcatgagaatggcatcgtc
cacagagatctaaagcctgaaaacctgctgtacctcacccctgaggagaactccaagatc
atgatcactgactttggtctatccaagatggagcagaatggagtcatgtccacagcttgt
gggaccccaggctacgtggctccagaagtgctggcccagaagccctacagtaaggctgtg
gactgctggtccattggtgtcatcacatacatactgctgtgtggctatccccctttctat
gaagaaacagaatcaaagctttttgagaagatcaaagagggttactacgagtttgagtct
ccgttctgggatgacatttctgagtcagccaaggattttatttgccatctgctggagaag
gacccaaacgaacggtacacctgcgagaaagccctcagacacccctggattgatggaaac
acagccctgcaccgggacatctatccatctgtcagcctccagattcagaagaactttgcc
aagagcaagtggaggcaagccttcaacgcagctgcggtggtgcatcacatgaggaaactg
cacatgaacctgcacagccccagtgtccgccaagaggtggagaacaggccacctgtgtcc
cctgctcctgaagtctccagaccagactcccatgacagctccatcacagaggcccccatc
ctggacccaagcacaccccttcctgcactgacccgactaccctgctcacacagctcccgg
ccttcagctcccagtggtggccgctcactcaactgcctggtcaacggctccctgcgcatc
agcagtagcctagtgcccatgcaacagggccccctagccacggggccctgtggctgctgc
tccagctgtctaaatattgggaacaagggaaagtcttcctactgctctgagcctaccctc
ttcagaaaggccaataaaaaacagaacttcaagtcagaggtcatggtaccagtgaaggct
ggtggcagcacccactgccggggtgggcagactggggtgtgtctcgttatgtga

KEGG   Mus musculus (mouse): 52163
Entry
52163             CDS       T01002                                 

Gene name
Camk1, AI505105, CaMKIalpha, Cam, Camk, D6Ertd263, D6Ertd263e
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase I
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu05214  Glioma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    52163 (Camk1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    52163 (Camk1)
   04925 Aldosterone synthesis and secretion
    52163 (Camk1)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    52163 (Camk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    52163 (Camk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     52163 (Camk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   52163 (Camk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH RIO1 Tyrosinase PaaA_PaaC
Other DBs
NCBI-GeneID: 52163
NCBI-ProteinID: NP_598687
MGI: 1098535
Ensembl: ENSMUSG00000030272
Vega: OTTMUSG00000022452
UniProt: Q91YS8 Q3UY68
Position
6 E3; 6 52.75 cM
AA seq 374 aa
MPGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKE
GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR
LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACG
TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP
YWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
SKWKQAFNATAVVRHMRKLQLGTSQEGQGQTGSHGELLTPTAGGPAAGCCCRDCCVEPGS
ELPPAPPPSSRAMD
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgccaggggcagtggaaggccccaggtggaagcaggcggaagacattagggatatttat
gacttcagagatgttctgggcacgggtgccttctcagaagtgatcctggcagaggacaag
aggactcagaaactggtggccatcaaatgcattgccaagaaagccctggagggcaaagaa
ggcagcatggagaacgagattgccgtcttacacaagatcaagcaccccaacattgtagcc
ctggatgacatctatgagagtgggggccacctctacctcatcatgcagctggtttcaggt
ggagagctgtttgaccgaattgtggagaaaggattctacacggaacgggatgccagccgc
ctcatcttccaggtgctggatgctgtcaagtacctgcacgacctgggcattgtgcaccgg
gatctcaagccagagaacctgctgtactacagtctggatgaagactccaaaatcatgatc
tctgactttggcctctccaagatggaggacccaggcagtgtgctctccacagcctgtggg
actccaggatatgtggcccctgaggtcctggcccagaagccctacagcaaggctgtggat
tgctggtccataggagtcattgcctatatactgctctgtggctacccacccttttatgat
gaaaatgatgccaaactctttgaacagattttgaaggcagagtatgagtttgactctcct
tattgggacgacatctctgactctgccaaagatttcatacgacatttgatggagaaagac
ccggagaagaggtttacctgtgagcaggccttgcagcacccatggattgcaggagataca
gctctggataagaatatccaccagtcagtgagcgagcagatcaagaagaactttgccaag
agcaagtggaagcaagctttcaatgccactgctgtggttcggcacatgaggaagctgcag
ctgggaaccagtcaggaggggcaggggcagactggcagccacggggagctgctgacacca
acagctggtgggccagcagctggctgctgctgccgagactgctgtgtggaaccaggctcg
gaactgccccctgcaccacccccaagctctagggccatggattga

DBGET integrated database retrieval system