KEGG   Mus musculus (mouse): 108071Help
Entry
108071            CDS       T01002                                 

Gene name
Grm5, 6430542K11Rik, AI850523, Glu5R, Gprc1e, mGluR5, mGluR5b
Definition
(RefSeq) glutamate receptor, metabotropic 5
  KO
K04604  metabotropic glutamate receptor 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04540  Gap junction
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    108071 (Grm5)
   04072 Phospholipase D signaling pathway
    108071 (Grm5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108071 (Grm5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108071 (Grm5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    108071 (Grm5)
   04720 Long-term potentiation
    108071 (Grm5)
   04723 Retrograde endocannabinoid signaling
    108071 (Grm5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    108071 (Grm5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    108071 (Grm5)
G protein-coupled receptors [BR:mmu04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   108071 (Grm5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G Peripla_BP_6 DUF5438
Motif
Other DBs
NCBI-GeneID: 108071
NCBI-ProteinID: NP_001137306
MGI: 1351342
Ensembl: ENSMUSG00000049583
Vega: OTTMUSG00000016489
UniProt: Q3UVX5 B2BH30 Q4VA56
Position
7; 7 D3
AA seq 1203 aa AA seqDB search
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSD
KTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGIC
IAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFLL
LGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQH
RFQCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCPG
YAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFDY
INVGSWDNGELKMDDDEVWSKKNNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENE
YVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIF
IIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSA
LVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMH
DYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTT
CIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTST
VVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMGN
GGRATMSSSNGKSVTWAQNEKSTRGQHLWQRLSVHINKKENPNQTAVIKPFPKSTESRGQ
GAGAGGGSGPGAAGAGSAGCTATGGPEPPDAGPKALYDVAEAEERFPAAARPRSPSPIST
LSHLAGSAGRTDDDAPSLHSETAARSSSSQGSLMEQISSVVTRFTANITELNSMMLSTAA
APGPPGTPICSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPATGPSPAQETPAGAE
AAPGKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTLIIRDYTQSS
SSL
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atggtccttctgttgattctgtcagtcctacttctgaaagaagatgtacgaggaagtgca
cagtccagtgagaggagggtggtggctcacatgccaggtgacattattattggagctctc
ttctcggtccaccaccaaccaactgtggacaaagttcatgagaggaagtgtggggcagtc
cgtgagcagtatggcattcagagagtggaagccatgctgcataccttggaaaggatcaat
tcagatcccacactcttgcccaacatcacactaggctgtgagataagagattcctgctgg
cattctgctgtggccctagagcaaagcattgagtttataagggattccctcatctcttcg
gaagaggaagaaggcttggtacgctgtgtagatggctcttcttccttccgctccaagaaa
cccatagtgggagtcattgggcctggctcgagttctgtggccattcaagttcagaacttg
ctccagcttttcaacatacctcagattgcttactctgcaactagcatggatttgagtgac
aagactctattcaagtacttcatgagggttgtaccttcggatgcccagcaagcccgagcc
atggtagacatagtgaagagatacaactggacttatgtctcagctgtgcacacagaaggc
aactatggagaaagtgggatggaggctttcaaagatatgtcagcgaaggaagggatttgc
atcgcccactcttacaaaatctacagcaatgctggggaacagagctttgacaagctgttg
aaaaagctcagaagtcatttacctaaagcccgggtggtagcctgcttctgtgaaggcatg
acagttcgaggtctgctcatggccatgagacgcttgggtctagcaggggaatttctactt
ctgggcagtgatggctgggctgacaggtatgacgtgacagatgggtatcagcgagaagct
gtcggtgggattacaatcaagctccagtctcctgatgtcaagtggtttgatgattattat
ctgaagctccggccagaaacaaacctcagaaacccttggtttcaagaattttggcagcat
cgttttcagtgccggctagaagggtttgcacaggagaacagcaagtacaacaagacttgc
aacagttctctaactctgagaacgcatcatgttcaagattccaaaatgggatttgtgatc
aatgcaatctattctatggcttatgggctccacaacatgcagatgtccctgtgtccaggc
tatgcaggcctctgtgatgcaatgaagccaattgatgggcggaaacttttggactccctg
atgaaaaccaactttactggagtttccggagatatgattctatttgatgaaaatggagac
tctccaggaaggtatgaaataatgaatttcaaggaaatgggaaaagattattttgattac
atcaatgttggaagttgggacaatggggaattaaaaatggatgatgatgaagtgtggtcc
aagaaaaataacatcatcagatctgtgtgcagtgaaccgtgtgagaaaggacagataaag
gtgatccggaagggagaagtcagctgttgttggacctgcacaccttgtaaggagaatgag
tatgtttttgatgagtacacctgcaaggcgtgccaactggggtcctggcccactgacgac
ttgacaggttgtgatttgatcccagtccagtatcttcgatggggtgaccctgagcccatt
gcagctgtggtgtttgcctgcctcggtctgctagccaccctcttcgttactgtaatcttc
atcatttatcgggacactccagtggtcaagtcttccagcagggaactctgctacattatc
cttgctggcatctgcctgggttacttgtgtaccttctgcctcattgcaaagcccaaacag
atttactgctaccttcagagaattggcatcggtctctctccagccatgagctactcagcc
cttgtaacgaagaccaaccgtattgcaaggattctagctggcagcaagaagaagatctgt
accaaaaagcccagattcatgagcgcctgtgctcagttagtgatcgctttcattctcatc
tgtatacagttgggtattattgtggccctctttatcatggagcctccggatataatgcat
gactatccaagcatccgagaagtctacttgatttgtaacaccaccaacctaggggttgtc
actcctcttggatacaatggattattgattttgagttgcacattctatgcgttcaagacc
agaaatgttccagccaactttaacgaggccaaatatattgctttcaccatgtacacaacc
tgcatcatatggctggcctttgtgcctatctactttggcagcaactacaaaatcatcacc
atgtgtttctcagtcagcctcagtgccacagtggccctgggttgcatgtttgtgccgaag
gtgtacatcatcctagccaaaccggagagaaatgtgcgcagcgccttcacaacctctaca
gtggtgcgcatgcacgtaggagatggcaagtcatcatccgctgccagcagatccagcagc
ctagtcaacctgtggaagaggaggggctcgtctggggaaaccctaaggtacaaagacagg
agactggcccagcacaagtcggaaatagagtgtttcacccccaaagggagtatggggaat
ggtgggagagcaacaatgagcagctccaatggaaaatccgtgacttgggcccagaatgag
aagagcacccgggggcagcacctgtggcagcgactgtctgtccatatcaacaagaaggag
aaccccaaccagacagcagtcatcaaacccttccccaagagcacagagagccgcgggcag
ggtgcaggggcaggtggtggctctggccccggtgcagctggtgctggtagcgcaggatgc
acagcgacaggcggcccagagccaccagacgccggccccaaggcgctttatgatgtcgca
gaggcagaggagcgcttcccagcggctgccaggccgcgctcgccatcgcccatcagtacg
ctgagccacctggcaggctcggcgggccgcacagacgacgacgcgccgtcgctgcactcg
gagaccgctgcacgcagcagctcatcccagggctcgctcatggagcagattagcagcgtg
gtgacgcgcttcaccgccaacatcaccgagctcaactccatgatgttgtccaccgcggct
gcgccggggccccctggtacccctatctgctcttcctacctgatccccaaagagatccag
ctgcccacgaccatgacgaccttcgcagagatccagcctctgccggccatcgaggtgacc
ggaggagctcagccggcgacagggccatcacctgcccaagagacgcccgcaggagctgaa
gccgccccaggaaaaccggatctggaggagctggtggccctcactccaccatcgcccttc
agggactcggtggactcggggagcaccaccccaaactctccagtctccgaatcggccctc
tgcatcccatcctctcccaaatatgacactctcatcatcagagattacacgcagagttct
tcatcgttgtga

DBGET integrated database retrieval system