KEGG   Mus musculus (mouse): 108071
Entry
108071            CDS       T01002                                 

Gene name
Grm5, 6430542K11Rik, AI850523, Glu, Glu5R, Gprc, Gprc1e, mGlu, mGluR5, mGluR5b
Definition
(RefSeq) glutamate receptor, metabotropic 5
  KO
K04604  metabotropic glutamate receptor 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04540  Gap junction
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu05010  Alzheimer disease
mmu05016  Huntington disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    108071 (Grm5)
   04072 Phospholipase D signaling pathway
    108071 (Grm5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108071 (Grm5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108071 (Grm5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    108071 (Grm5)
   04720 Long-term potentiation
    108071 (Grm5)
   04723 Retrograde endocannabinoid signaling
    108071 (Grm5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108071 (Grm5)
   05016 Huntington disease
    108071 (Grm5)
   05022 Pathways of neurodegeneration - multiple diseases
    108071 (Grm5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    108071 (Grm5)
G protein-coupled receptors [BR:mmu04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   108071 (Grm5)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G Peripla_BP_6 DUF5438
Other DBs
NCBI-GeneID: 108071
NCBI-ProteinID: NP_001137306
MGI: 1351342
Ensembl: ENSMUSG00000049583
Vega: OTTMUSG00000016489
UniProt: Q3UVX5 B2BH30 Q4VA56
Position
7; 7 D3
AA seq 1203 aa
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSD
KTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGIC
IAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFLL
LGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQH
RFQCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCPG
YAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFDY
INVGSWDNGELKMDDDEVWSKKNNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENE
YVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIF
IIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSA
LVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMH
DYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTT
CIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTST
VVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMGN
GGRATMSSSNGKSVTWAQNEKSTRGQHLWQRLSVHINKKENPNQTAVIKPFPKSTESRGQ
GAGAGGGSGPGAAGAGSAGCTATGGPEPPDAGPKALYDVAEAEERFPAAARPRSPSPIST
LSHLAGSAGRTDDDAPSLHSETAARSSSSQGSLMEQISSVVTRFTANITELNSMMLSTAA
APGPPGTPICSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPATGPSPAQETPAGAE
AAPGKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTLIIRDYTQSS
SSL
NT seq 3612 nt   +upstreamnt  +downstreamnt
atggtccttctgttgattctgtcagtcctacttctgaaagaagatgtacgaggaagtgca
cagtccagtgagaggagggtggtggctcacatgccaggtgacattattattggagctctc
ttctcggtccaccaccaaccaactgtggacaaagttcatgagaggaagtgtggggcagtc
cgtgagcagtatggcattcagagagtggaagccatgctgcataccttggaaaggatcaat
tcagatcccacactcttgcccaacatcacactaggctgtgagataagagattcctgctgg
cattctgctgtggccctagagcaaagcattgagtttataagggattccctcatctcttcg
gaagaggaagaaggcttggtacgctgtgtagatggctcttcttccttccgctccaagaaa
cccatagtgggagtcattgggcctggctcgagttctgtggccattcaagttcagaacttg
ctccagcttttcaacatacctcagattgcttactctgcaactagcatggatttgagtgac
aagactctattcaagtacttcatgagggttgtaccttcggatgcccagcaagcccgagcc
atggtagacatagtgaagagatacaactggacttatgtctcagctgtgcacacagaaggc
aactatggagaaagtgggatggaggctttcaaagatatgtcagcgaaggaagggatttgc
atcgcccactcttacaaaatctacagcaatgctggggaacagagctttgacaagctgttg
aaaaagctcagaagtcatttacctaaagcccgggtggtagcctgcttctgtgaaggcatg
acagttcgaggtctgctcatggccatgagacgcttgggtctagcaggggaatttctactt
ctgggcagtgatggctgggctgacaggtatgacgtgacagatgggtatcagcgagaagct
gtcggtgggattacaatcaagctccagtctcctgatgtcaagtggtttgatgattattat
ctgaagctccggccagaaacaaacctcagaaacccttggtttcaagaattttggcagcat
cgttttcagtgccggctagaagggtttgcacaggagaacagcaagtacaacaagacttgc
aacagttctctaactctgagaacgcatcatgttcaagattccaaaatgggatttgtgatc
aatgcaatctattctatggcttatgggctccacaacatgcagatgtccctgtgtccaggc
tatgcaggcctctgtgatgcaatgaagccaattgatgggcggaaacttttggactccctg
atgaaaaccaactttactggagtttccggagatatgattctatttgatgaaaatggagac
tctccaggaaggtatgaaataatgaatttcaaggaaatgggaaaagattattttgattac
atcaatgttggaagttgggacaatggggaattaaaaatggatgatgatgaagtgtggtcc
aagaaaaataacatcatcagatctgtgtgcagtgaaccgtgtgagaaaggacagataaag
gtgatccggaagggagaagtcagctgttgttggacctgcacaccttgtaaggagaatgag
tatgtttttgatgagtacacctgcaaggcgtgccaactggggtcctggcccactgacgac
ttgacaggttgtgatttgatcccagtccagtatcttcgatggggtgaccctgagcccatt
gcagctgtggtgtttgcctgcctcggtctgctagccaccctcttcgttactgtaatcttc
atcatttatcgggacactccagtggtcaagtcttccagcagggaactctgctacattatc
cttgctggcatctgcctgggttacttgtgtaccttctgcctcattgcaaagcccaaacag
atttactgctaccttcagagaattggcatcggtctctctccagccatgagctactcagcc
cttgtaacgaagaccaaccgtattgcaaggattctagctggcagcaagaagaagatctgt
accaaaaagcccagattcatgagcgcctgtgctcagttagtgatcgctttcattctcatc
tgtatacagttgggtattattgtggccctctttatcatggagcctccggatataatgcat
gactatccaagcatccgagaagtctacttgatttgtaacaccaccaacctaggggttgtc
actcctcttggatacaatggattattgattttgagttgcacattctatgcgttcaagacc
agaaatgttccagccaactttaacgaggccaaatatattgctttcaccatgtacacaacc
tgcatcatatggctggcctttgtgcctatctactttggcagcaactacaaaatcatcacc
atgtgtttctcagtcagcctcagtgccacagtggccctgggttgcatgtttgtgccgaag
gtgtacatcatcctagccaaaccggagagaaatgtgcgcagcgccttcacaacctctaca
gtggtgcgcatgcacgtaggagatggcaagtcatcatccgctgccagcagatccagcagc
ctagtcaacctgtggaagaggaggggctcgtctggggaaaccctaaggtacaaagacagg
agactggcccagcacaagtcggaaatagagtgtttcacccccaaagggagtatggggaat
ggtgggagagcaacaatgagcagctccaatggaaaatccgtgacttgggcccagaatgag
aagagcacccgggggcagcacctgtggcagcgactgtctgtccatatcaacaagaaggag
aaccccaaccagacagcagtcatcaaacccttccccaagagcacagagagccgcgggcag
ggtgcaggggcaggtggtggctctggccccggtgcagctggtgctggtagcgcaggatgc
acagcgacaggcggcccagagccaccagacgccggccccaaggcgctttatgatgtcgca
gaggcagaggagcgcttcccagcggctgccaggccgcgctcgccatcgcccatcagtacg
ctgagccacctggcaggctcggcgggccgcacagacgacgacgcgccgtcgctgcactcg
gagaccgctgcacgcagcagctcatcccagggctcgctcatggagcagattagcagcgtg
gtgacgcgcttcaccgccaacatcaccgagctcaactccatgatgttgtccaccgcggct
gcgccggggccccctggtacccctatctgctcttcctacctgatccccaaagagatccag
ctgcccacgaccatgacgaccttcgcagagatccagcctctgccggccatcgaggtgacc
ggaggagctcagccggcgacagggccatcacctgcccaagagacgcccgcaggagctgaa
gccgccccaggaaaaccggatctggaggagctggtggccctcactccaccatcgcccttc
agggactcggtggactcggggagcaccaccccaaactctccagtctccgaatcggccctc
tgcatcccatcctctcccaaatatgacactctcatcatcagagattacacgcagagttct
tcatcgttgtga

KEGG   Mus musculus (mouse): 12669
Entry
12669             CDS       T01002                                 

Gene name
Chrm1, AW49504, Chrm-, Chrm-1, M1, M1R
Definition
(RefSeq) cholinergic receptor, muscarinic 1, CNS
  KO
K04129  muscarinic acetylcholine receptor M1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04725  Cholinergic synapse
mmu04810  Regulation of actin cytoskeleton
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    12669 (Chrm1)
   04024 cAMP signaling pathway
    12669 (Chrm1)
   04151 PI3K-Akt signaling pathway
    12669 (Chrm1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12669 (Chrm1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    12669 (Chrm1)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    12669 (Chrm1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12669 (Chrm1)
   05022 Pathways of neurodegeneration - multiple diseases
    12669 (Chrm1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12669 (Chrm1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    12669 (Chrm1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srbc 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 12669
NCBI-ProteinID: NP_001106167
MGI: 88396
Ensembl: ENSMUSG00000032773
Vega: OTTMUSG00000039794
UniProt: P12657
Position
19; 19 A
AA seq 460 aa
MNTSVPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaacacctcagtgccccctgctgtcagtcccaacatcaccgtcttggcaccaggaaag
ggtccctggcaagtggcattcatcgggatcaccacaggcctcctgtctctggctacagtg
acaggcaacctgctggtgctcatctccttcaaggtcaacacagagctcaagacagtcaac
aactacttcctgctgagcctggcctgtgctgatctcatcattggcactttctccatgaac
ctctataccacatacctgctcatgggccactgggctctgggcacactggcctgtgacctc
tggctggccctggactatgtggccagcaacgcctctgtcatgaatcttctgctcatcagc
tttgaccgttacttctcagtgacccgacccctgagctaccgagccaagcgcactccccgc
agggcagctctgatgattggcctcgcgtggttggtttccttcgttctctgggccccagcc
atcctcttctggcaatacctagttggggagcggacagtgctggctgggcagtgctacatc
cagttcctctcccaacccatcatcacttttggcacagccatggccgccttctacctccct
gtcacagtcatgtgtacgctgtactggcgcatctaccgggagacagaaaaccgagcccgg
gagctagcagccctacagggctctgagacaccaggcaaaggtggtggcagcagcagcagc
tcagagaggtcacagccaggagctgaaggctcacccgagtcacctccaggccgctgctgt
cgctgttgccgggcacccagacttctgcaggcctacagctggaaagaagaagaggaagag
gatgaaggctccatggagtccctcacatcctctgaaggtgaggagcctggctcagaagtg
gtgatcaagatgcctatggtagatcctgaggcacaggcacccaccaagcagcctcccaaa
agctccccaaatacagtcaagaggcccaccaagaaaggccgagaccgaggcggcaaaggc
caaaaaccccgagggaaggaacaactggccaagagaaagaccttctcactggtcaaggag
aagaaggcagctcggaccctgagtgccatcctgctggccttcatcctcacctggacacca
tataacatcatggtgctggtgtctacattctgcaaggactgtgttccagaaaccctatgg
gagctgggctactggctttgctacgtcaacagcactgtcaaccccatgtgctacgcactc
tgcaacaaagccttccgggacactttccgcctgctgttgctctgccgctgggacaagcgg
cgctggcgcaaaatccccaagcgccctggctctgtgcaccgcaccccctcccgccaatgc
taa

KEGG   Mus musculus (mouse): 12671
Entry
12671             CDS       T01002                                 

Gene name
Chrm3, Chrm-, Chrm-3, M3, M3R
Definition
(RefSeq) cholinergic receptor, muscarinic 3, cardiac
  KO
K04131  muscarinic acetylcholine receptor M3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04725  Cholinergic synapse
mmu04742  Taste transduction
mmu04810  Regulation of actin cytoskeleton
mmu04911  Insulin secretion
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    12671 (Chrm3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12671 (Chrm3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    12671 (Chrm3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    12671 (Chrm3)
  09154 Digestive system
   04970 Salivary secretion
    12671 (Chrm3)
   04971 Gastric acid secretion
    12671 (Chrm3)
   04972 Pancreatic secretion
    12671 (Chrm3)
  09156 Nervous system
   04725 Cholinergic synapse
    12671 (Chrm3)
  09157 Sensory system
   04742 Taste transduction
    12671 (Chrm3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12671 (Chrm3)
   05022 Pathways of neurodegeneration - multiple diseases
    12671 (Chrm3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12671 (Chrm3)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    12671 (Chrm3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 12671
NCBI-ProteinID: NP_150372
MGI: 88398
Ensembl: ENSMUSG00000046159
Vega: OTTMUSG00000048429
UniProt: Q9ERZ3 Q542R4
Position
13 A1; 13 3.72 cM
AA seq 589 aa
MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVSQLDSYNISQTSGNFSSNDTSSDPLG
GHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS
MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRT
TKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFY
MPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQGTK
RSSRRKYGGCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSET
RAIYSIVLKLPGHSTILNSTKLPSSDNLQVPDKDLGTMDVERNAHKLQAQKSMDDRDNCQ
KDFSKLPIQLESAVDTAKTSDTNSSVDKTTAALPLSFKEATLAKRFALKTRSQITKRKRM
SLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNP
VCYALCNKTFRTTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgaccttgcacagtaacagtacaacctcgcctttgtttcccaacatcagctcttcctgg
gtgcacagtccctcagaggcggggctgcccttggggacagtctctcaattggacagctac
aacatttcccaaacctctgggaatttctcctcaaatgacacctccagtgaccctctaggg
ggccacaccatctggcaagtggtcttcattgcattcttgactggcttcctggcattggtg
accatcatcggcaacatccttgtcattgtggcatttaaggtcaacaaacagctgaagaca
gtcaacaactacttcctcttaagcctggcctgcgcagatctgatcatcggggtcatttcc
atgaacctgttcacgacctacatcattatgaaccgctgggctctggggaacttagcctgt
gacctctggctttccattgactatgtggccagcaatgcttctgtcatgaatctgctggtg
atcagctttgacaggtacttttctattaccaggccactcacttaccgagccaaacgaaca
acaaaacgagccggtgtgatgattggtctggcttgggtcatctcctttgtcctgtgggct
cctgccatcttgttctggcaatactttgtagggaagagaactgtgccccccggagaatgt
ttcattcagtttctaagtgagcccaccatcaccttcggcacggcgatcgctgccttttac
atgcctgtcaccatcatgactattttatactggagaatctataaggagactgagaaacgt
accaaagagctggctgggctacaggcctctgggacagaagcggaagcagaaaactttgtc
caccccacaggcagttctcgaagctgtagcagctatgagctacaacagcaaggcacgaaa
cggtcatctaggaggaagtatggtggctgtcacttctggttcacaactaagagctggaag
cccagtgctgagcagatggaccaagaccacagtagcagtgacagttggaataacaacgat
gctgctgcctccctggaaaactctgcttcttctgatgaagaggatattggctcagagacc
agagccatctattccattgtactcaagctgccgggtcatagcaccatcctcaactctacc
aagctaccctcctcagataacctgcaggtgccagacaaggacctggggactatggatgta
gagagaaatgcccataagcttcaggcccagaagagtatggatgaccgtgacaactgtcag
aaggacttctccaagctccccatccagttagagtctgccgtggacacagccaagacctct
gacaccaactcctcggtggacaagaccacggccgctctacctctgtccttcaaagaagcc
acgctggctaagaggtttgctctcaagaccagaagtcagatcaccaagcggaaaaggatg
tcgctcatcaaggagaagaaggccgcccagacactcagtgccatcttgctggctttcatc
atcacgtggaccccctacaacatcatggtcctggtgaacaccttctgtgacagctgcata
cccaaaacctattggaatctgggctactggctgtgctatatcaacagcaccgtgaacccc
gtgtgctatgccctgtgcaacaagacattcagaaccaccttcaagatgcttctcttatgc
cagtgtgacaagaggaagcggcgcaaacagcagtaccagcagagacagtccgtcattttt
cacaagcgagtgcctgagcaggccttgtag

KEGG   Mus musculus (mouse): 213788
Entry
213788            CDS       T01002                                 

Gene name
Chrm5, AChR-M5, M5R, m5
Definition
(RefSeq) cholinergic receptor, muscarinic 5
  KO
K04133  muscarinic acetylcholine receptor M5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04725  Cholinergic synapse
mmu04810  Regulation of actin cytoskeleton
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    213788 (Chrm5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    213788 (Chrm5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    213788 (Chrm5)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    213788 (Chrm5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    213788 (Chrm5)
   05022 Pathways of neurodegeneration - multiple diseases
    213788 (Chrm5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    213788 (Chrm5)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    213788 (Chrm5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srbc
Other DBs
NCBI-GeneID: 213788
NCBI-ProteinID: NP_991352
MGI: 109248
Ensembl: ENSMUSG00000074939
Vega: OTTMUSG00000015145
UniProt: Q920H4
Position
2 E3; 2 57.02 cM
AA seq 532 aa
MEGESYHNETTVNGTPVNHQALERHGLWEVITIAAVTAVVSLMTIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWVLGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLVSFILWAPAILCWQYLVGKRTVPP
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVAEVK
KRKPAHRTLLRSFFSCPRPSLAQRVRNQASWSSSRRSTSTTGKPTQATDLSADWEKAEQV
TNCSSCPSSEDEAKATTDPVFQVVCKNEAKESPGKEFNTQETKETFVSPRTENNDYDTPK
YFLSPGAAHRLKSQKCVAYKFRLVVKADGTQETNNGCRKVKIMPCSFPVSKDPSTKGLDP
HLSHQMTKRKRMVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTINPICYALCNRTFRKTFKLLLLCRWKKKKVEEKLYWQGNSKLP
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggaaggggagtcttatcacaatgaaaccactgtcaacggcaccccagtaaatcaccag
gctttggaacgccatggactgtgggaagtcattactattgcagctgtgaccgctgtggtc
agtctgatgaccattgtcggcaatgtcttggtcatgatctccttcaaagtcaacagtcag
ctcaagacagttaacaactattacctgctcagcttggcctgtgcagacctcatcattggc
atcttctccatgaacctctacacgacctacatcctcatgggacgctgggttctcgggagt
ctggcctgtgacctttggcttgcactcgactatgtagccagcaacgcttctgtcatgaac
cttctggtgattagctttgatcgttacttttccatcacaagaccactgacataccgagcc
aagcgtaccccaaagagggctggcatcatgatcggcttggcatggctggtctccttcatc
ctctgggcgccagccatcctctgctggcagtacttggtcgggaagcggacagtaccacct
gatgagtgccagatccagttcctctctgagcccaccatcacttttgggaccgccattgcc
gctttctatatccctgtctccgtcatgaccatactctactgccggatctaccgggaaaca
gagaaacgaaccaaggacctggctgacctccaaggttccgattctgtggcagaagtcaag
aagagaaaaccggctcacaggaccctgctcagatctttctttagctgccctagacccagc
ctggcccagagagtacggaaccaggcctcctggtcatcctcccgtagaagcacctcaaca
acgggaaagccaacccaggccactgatctaagtgctgactgggaaaaggctgagcaggtt
accaactgtagcagctgcccctcttcagaggacgaagccaaggccaccactgaccctgtc
tttcaagtggtctgcaagaatgaggccaaggaaagcccggggaaggaattcaatacccaa
gagaccaaggaaacgtttgtgagccctcggactgaaaacaatgactatgacactcccaag
tacttcctgtctccaggtgctgctcacagactcaagagtcagaagtgtgttgcctataag
ttccgattggtggtaaaagctgacgggacccaggagacaaacaatggctgtcgtaaggtg
aaaatcatgccctgttccttcccagtgtccaaagacccttcaacaaaaggcctggatccc
cacctcagccatcaaatgaccaaacgaaagagaatggtcctagtcaaagagaggaaagcg
gcgcagaccttgagcgccattctcctggccttcatcatcacatggactccttataacatc
atggtcctggtttccaccttctgtgacaagtgtgtccctgtcaccctgtggcacttgggt
tactggctgtgctatgtcaacagcaccatcaaccccatctgttacgctctctgcaacaga
accttcaggaagacctttaagctgctgcttctctgccggtggaaaaagaaaaaagtagaa
gagaaattgtattggcaaggcaacagcaagctaccctga

DBGET integrated database retrieval system