KEGG   Mus musculus (mouse): 108079
Entry
108079            CDS       T01002                                 

Gene name
Prkaa2, 2310008I11Rik, A830082D05, AMPKalpha2
Definition
(RefSeq) protein kinase, AMP-activated, alpha 2 catalytic subunit
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04371  Apelin signaling pathway
mmu04530  Tight junction
mmu04710  Circadian rhythm
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108079 (Prkaa2)
   04068 FoxO signaling pathway
    108079 (Prkaa2)
   04151 PI3K-Akt signaling pathway
    108079 (Prkaa2)
   04152 AMPK signaling pathway
    108079 (Prkaa2)
   04150 mTOR signaling pathway
    108079 (Prkaa2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108079 (Prkaa2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108079 (Prkaa2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108079 (Prkaa2)
   04922 Glucagon signaling pathway
    108079 (Prkaa2)
   04920 Adipocytokine signaling pathway
    108079 (Prkaa2)
   04921 Oxytocin signaling pathway
    108079 (Prkaa2)
  09149 Aging
   04211 Longevity regulating pathway
    108079 (Prkaa2)
   04213 Longevity regulating pathway - multiple species
    108079 (Prkaa2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    108079 (Prkaa2)
   04714 Thermogenesis
    108079 (Prkaa2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108079 (Prkaa2)
   05410 Hypertrophic cardiomyopathy (HCM)
    108079 (Prkaa2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    108079 (Prkaa2)
   04931 Insulin resistance
    108079 (Prkaa2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    108079 (Prkaa2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    108079 (Prkaa2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    108079 (Prkaa2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     108079 (Prkaa2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   108079 (Prkaa2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    108079 (Prkaa2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    108079 (Prkaa2)
  Mitophagy factors
   Other mitophagy factors
    108079 (Prkaa2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 108079
NCBI-ProteinID: NP_835279
MGI: 1336173
Ensembl: ENSMUSG00000028518
Vega: OTTMUSG00000008125
UniProt: Q8BRK8
Position
4; 4 C6
AA seq 552 aa
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEVEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAQMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPDYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKACDIMAEVY
RAMKQLGFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDSRSYLLDFKSIDDEVVEQR
SGSSTPQRSCSAAGLHRARSSFDSSTAENHSLSGSLTGSLTGSTLSSASPRLGSHTMDFF
EMCASLITALAR
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgggtgaagatcggacactacgtcctgggggac
accctgggcgtcggcaccttcggcaaagtgaagattggagaacaccaattgacaggccat
aaagtggcagttaagatcttaaatagacagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaatcttaaactctttcgtcatcctcatattatcaaactctac
caggtgatcagcactccgacagacttttttatggtaatggaatatgtgtctggaggtgaa
ttgttcgactacatctgcaaacatgggcgggttgaagaggtggaagcgcgccggctcttc
cagcagatcctgtctgccgtggattactgtcacaggcatatggttgtccatagggacctg
aagccagagaatgtgctgctggatgcccagatgaacgctaagatagctgactttggacta
tctaatatgatgtcagatggtgaatttctacgaactagctgtggatcgccaaattatgca
gcacctgaggtcatctcaggaaggctgtatgcaggtcccgaggtcgatatctggagctgt
ggtgtcatcctgtatgcccttctctgtggcaccctccctttcgatgatgagcacgtgcct
acgctcttcaagaagatccgagggggtgtgttttacatcccagactatctcaaccgttct
gtcgccactctgctgatgcacatgctccaggtggaccccctgaagcgagcgactatcaaa
gacatacgagaacatgaatggtttaaacaggatttgcccagctacctatttcctgaagac
ccctcctacgatgcgaatgtcattgacgatgaggctgtgaaggaagtctgtgagaaattc
gagtgtacagagtcagaagtgatgaatagtctgtatagtggtgaccctcaagaccagctt
gcagtggcttatcatcttatcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctctagtcctccatcaggttcttttatggatgacagcgccatgcatattcct
ccaggcttgaaaccacatccagaaaggatgccgcctctcatcgcagacagccccaaagca
cgctgtccactggatgcactcaacacaacgaagcccaagtctctagctgtgaaaaaagcc
aagtggcatcttggaatccgaagccagagcaaagcgtgtgacattatggctgaagtgtac
cgagctatgaagcagctgggttttgaatggaaggtagtgaatgcataccatcttcgagta
agaagaaaaaacccagtgactggcaactatgtgaaaatgagcttacagctttacctggta
gacagtcggagctatcttctggacttcaaaagcatcgatgatgaggtggtggagcagagg
tctggttcttcaacaccccagcgctcctgttctgctgcgggcctccacagagcacggtca
agttttgattccagcacagctgagaaccactccctttctggctctctcactggctctttg
actggcagcactttgtcctcggcatccccgcgcctgggcagtcacaccatggattttttt
gaaatgtgcgccagtcttatcactgctttagctcgttga

DBGET integrated database retrieval system