KEGG   Mus musculus (mouse): 108083
Entry
108083            CDS       T01002                                 

Symbol
Pip4k2b, AI848124, PI5P4Kbeta, Pip5k2b, c11
Name
(RefSeq) phosphatidylinositol-5-phosphate 4-kinase, type II, beta
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108083 (Pip4k2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    108083 (Pip4k2b)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108083 (Pip4k2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     108083 (Pip4k2b)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 108083
NCBI-ProteinID: NP_473392
MGI: 1934234
Ensembl: ENSMUSG00000018547
Vega: OTTMUSG00000002742
UniProt: Q80XI4 Q3UJ95
Position
11 D; 11 61.07 cM
AA seq 416 aa
MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNV
PVPVMLMPDDFKAYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNS
VTRSAPINSDSQGRCGTRFLTTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLL
PQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKD
NDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEEMEVEE
RAEEEECENDGVGGSLLCSYGTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESAPKK
EVYFMAIIDILTPYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFNEFMSNILT
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgtcgtccaactgcaccagcaccacggcggtggcggtggcgccgctcagcgccagcaaa
accaagaccaagaagaagcatttcgtgtgccagaaagtgaagctattccgggccagcgag
ccgattctcagcgtcctgatgtggggggtgaaccacacgatcaatgagctgagcaatgtc
cctgttcctgtcatgctaatgccggatgacttcaaagcttacagcaagatcaaggtggac
aatcatctcttcaataaggaaaacctccccagccgcttcaagttcaaggagtactgcccc
atggtgttccgaaacctcagggagaggttcggcatcgatgaccaggactaccagaattca
gtgacacgcagtgcacctatcaacagtgacagccagggcaggtgtggcactcgcttcctc
accacctatgaccggcgtttcgtcatcaagactgtgtcaagtgaggatgtggccgagatg
cacaacatcctaaagaaataccaccagttcatagtggaatgtcacggcaataccctcttg
ccacagttcctgggcatgtaccgcctgaccgtggatggggtggaaacctacatggtggtc
accaggaatgtattcagtcatcggcttactgtgcatcgcaaatacgacctgaagggttcc
actgttgccagagaagccagtgacaaggaaaaggctaaggacttgccaactttcaaagat
aatgacttcctcaacgaagggcagaagctgcacgtgggagaagagagcaaaaagaacttc
ctggaaaaactgaagcgggacgttgagttcctggcccagctgaagatcatggattacagt
ctcctggtgggcatccacgacgtggaccgggcagagcaggaggagatggaggtggaagag
cgagcggaggaggaggaatgcgagaatgatggggtgggtggcagcctgctctgctcctat
ggcacgcctccagacagccctggcaacctcctgagcttcccccggttcttcggcccagga
gagttcgacccctctgtggacgtctatgccatgaaaagccatgaaagtgcccctaagaag
gaggtctatttcatggccatcattgacatcctcacaccctatgacgctaagaagaaagct
gcacacgccgccaaaacggtgaaacatggggcaggggctgagatctccactgtgaacccg
gagcagtactcaaaacgcttcaacgagttcatgtccaacatcctgacgtaa

DBGET integrated database retrieval system