KEGG   Mus musculus (mouse): 108083Help
Entry
108083            CDS       T01002                                 

Gene name
Pip4k2b, AI848124, PI5P4Kbeta, Pip5k2b, c11
Definition
(RefSeq) phosphatidylinositol-5-phosphate 4-kinase, type II, beta
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108083 (Pip4k2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    108083 (Pip4k2b)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108083 (Pip4k2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     108083 (Pip4k2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K
Motif
Other DBs
NCBI-GeneID: 108083
NCBI-ProteinID: NP_473392
MGI: 1934234
Ensembl: ENSMUSG00000018547
Vega: OTTMUSG00000002742
UniProt: Q80XI4 Q3UJ95
Position
11 D; 11 61.07 cM
AA seq 416 aa AA seqDB search
MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNV
PVPVMLMPDDFKAYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNS
VTRSAPINSDSQGRCGTRFLTTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLL
PQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKD
NDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEEMEVEE
RAEEEECENDGVGGSLLCSYGTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESAPKK
EVYFMAIIDILTPYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFNEFMSNILT
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccaactgcaccagcaccacggcggtggcggtggcgccgctcagcgccagcaaa
accaagaccaagaagaagcatttcgtgtgccagaaagtgaagctattccgggccagcgag
ccgattctcagcgtcctgatgtggggggtgaaccacacgatcaatgagctgagcaatgtc
cctgttcctgtcatgctaatgccggatgacttcaaagcttacagcaagatcaaggtggac
aatcatctcttcaataaggaaaacctccccagccgcttcaagttcaaggagtactgcccc
atggtgttccgaaacctcagggagaggttcggcatcgatgaccaggactaccagaattca
gtgacacgcagtgcacctatcaacagtgacagccagggcaggtgtggcactcgcttcctc
accacctatgaccggcgtttcgtcatcaagactgtgtcaagtgaggatgtggccgagatg
cacaacatcctaaagaaataccaccagttcatagtggaatgtcacggcaataccctcttg
ccacagttcctgggcatgtaccgcctgaccgtggatggggtggaaacctacatggtggtc
accaggaatgtattcagtcatcggcttactgtgcatcgcaaatacgacctgaagggttcc
actgttgccagagaagccagtgacaaggaaaaggctaaggacttgccaactttcaaagat
aatgacttcctcaacgaagggcagaagctgcacgtgggagaagagagcaaaaagaacttc
ctggaaaaactgaagcgggacgttgagttcctggcccagctgaagatcatggattacagt
ctcctggtgggcatccacgacgtggaccgggcagagcaggaggagatggaggtggaagag
cgagcggaggaggaggaatgcgagaatgatggggtgggtggcagcctgctctgctcctat
ggcacgcctccagacagccctggcaacctcctgagcttcccccggttcttcggcccagga
gagttcgacccctctgtggacgtctatgccatgaaaagccatgaaagtgcccctaagaag
gaggtctatttcatggccatcattgacatcctcacaccctatgacgctaagaagaaagct
gcacacgccgccaaaacggtgaaacatggggcaggggctgagatctccactgtgaacccg
gagcagtactcaaaacgcttcaacgagttcatgtccaacatcctgacgtaa

KEGG   Mus musculus (mouse): 117150Help
Entry
117150            CDS       T01002                                 

Gene name
Pip4k2c, Pip5k2c
Definition
(RefSeq) phosphatidylinositol-5-phosphate 4-kinase, type II, gamma
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    117150 (Pip4k2c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    117150 (Pip4k2c)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    117150 (Pip4k2c)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     117150 (Pip4k2c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K
Motif
Other DBs
NCBI-GeneID: 117150
NCBI-ProteinID: NP_473438
MGI: 2152214
Ensembl: ENSMUSG00000025417
UniProt: Q91XU3
Position
10; 10 D3
AA seq 421 aa AA seqDB search
MASSSVPPATAPAAAGGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSIN
ELSQVPPPVMLLPDDFKASSKIKVNNHFFHRENLPSHFKFKEYCPQVFRNLRDRFAIDDH
DYLVSLTRSPPSETEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNT
LLPQFLGMYRVSVENEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTL
KDMDFLNKNQKVYIGEEEKKVFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEG
PVREEESEWDGDCNLAGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAE
GAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFIANIF
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctcctccgtccctcccgccaccgcacccgcggcagctggaggccccggcccg
ggattcggcttcgcctccaaaaccaagaagaagcatttcgtacagcagaaagtgaaggtg
ttccgggccgcggacccgctggtgggcgtgttcctgtggggcgtcgctcactcgatcaat
gagctcagccaggtaccgcccccagtgatgttgctgccagatgactttaaagccagctcc
aagatcaaggtcaacaatcactttttccatagagaaaatcttcccagtcatttcaagttc
aaggagtattgtccccaggtcttcaggaacctgagagatcggtttgccatcgatgatcac
gattacttggtgtcccttactcgaagccccccaagcgaaactgaaggcagtgatggccgt
ttccttatctcctatgaccgcactctggtcatcaaggaagtgtcgagcgaagatattgcg
gatatgcacagcaacctctccaactaccaccagtacatagtgaaatgtcatggcaacacg
cttctgccccagttcctgggcatgtaccgagtcagtgtagaaaatgaagacagctacatg
ctcgtgatgcgcaatatgtttagtcatcgtcttcctgtgcataggaagtatgacctcaag
ggctctctagtgtcccgggaagccagcgataaggaaaaggttaaagaactgccaacacta
aaggatatggactttcttaacaagaaccagaaagtgtatattggtgaagaagaaaagaaa
gtattcctggagaagctgaagcgagatgtggagtttctagtgcagctgaagatcatggac
tacagcctcctgttgggcatccacgacatcatccggggctctgaacccgaggaagagggg
cctgtgagggaggaggagtctgagtgggatggggactgtaacctggctggacctcccgcc
ctggtgggctcctatggtacctcccctgagggtatcggaggctacatccattcccaccgg
ccactgggcccaggagagtttgagtccttcatcgatgtctatgctatccggagtgcggag
ggggccccccagaaggaggtgtatttcatgggcctcattgacattctgacacagtatgat
gccaagaagaaagcagctcatgcagccaagactgtcaagcacggggcgggggcagagatc
tccactgtccatcctgagcagtatgctaagcgattcctggactttattgccaacatcttt
gcctaa

KEGG   Mus musculus (mouse): 18718Help
Entry
18718             CDS       T01002                                 

Gene name
Pip4k2a, AW742916, Pip5k2a
Definition
(RefSeq) phosphatidylinositol-5-phosphate 4-kinase, type II, alpha
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18718 (Pip4k2a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    18718 (Pip4k2a)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18718 (Pip4k2a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     18718 (Pip4k2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K
Motif
Other DBs
NCBI-GeneID: 18718
NCBI-ProteinID: NP_032871
MGI: 1298206
Ensembl: ENSMUSG00000026737
Vega: OTTMUSG00000011477
UniProt: O70172 Q544E3
Position
2; 2 A3
AA seq 405 aa AA seqDB search
MATPGNLGSSVLASKTKTKKKHFVAQKVKLFRASDPLLSVLMWGVNHSINELSHVQIPVM
LMPDDFKAYSKIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGIDDQDFQNSLTRSA
PLPNDSQARSGARFHTSYDKRYVIKTITSEDVAEMHNILKKYHQYIVECHGVTLLPQFLG
MYRLNVDGVEIYVIVTRNVFSHRLSVYRKYDLKGSTVAREASDKEKAKELPTLKDNDFIN
EGQKIYIDDNNKKIFLEKLKKDVEFLAQLKLMDYSLLVGIHDVERAEQEEVECEENDGEE
EGESDSTHPIGTPPDSPGNTLNSSPPLAPGEFDPNIDVYAIKCHENAPRKEVYFMAIIDI
LTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIGHIL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccctggcaacctggggtcctccgtcctggcgagcaagaccaagacgaagaag
aagcacttcgtggctcagaaagtgaagctgttccgggccagcgacccgctgctcagcgtg
ctcatgtggggggtcaaccattcgatcaatgaactgagccacgttcaaatccctgtcatg
ttgatgcctgatgacttcaaagcctactcaaagataaaggttgacaaccacctttttaac
aaggaaaacatgccgagccatttcaagtttaaggaatactgcccaatggtcttccggaat
ctgcgggagaggtttggaatcgacgaccaagatttccagaattccttgaccagaagtgca
ccccttcccaatgactcccaggctcgcagcggggctcggtttcacacgtcttatgataaa
agatacgtcatcaagaccattaccagtgaggacgtggcagagatgcacaacatcctgaag
aagtaccaccagtatatagtggaatgtcatggggtcacacttcttcctcagttcttggga
atgtaccggcttaatgtcgatggagtggaaatatatgtgattgttacaaggaatgtgttc
agccaccggctatctgtatataggaaatacgacttaaagggctcgacagtggctagagaa
gctagtgataaagaaaaggccaaagagctgccaactttaaaggataatgacttcatcaat
gagggccaaaagatctatattgatgacaacaacaaaaagatattcctagaaaaactgaaa
aaggatgtcgagttccttgcacagttaaaactcatggactacagcctcctggtggggatt
cacgatgtggagcgagcagagcaggaggaggtggagtgtgaggagaacgatggggaagaa
gaaggagagagtgacagcacccacccgatcgggacgccaccagacagtcccggaaataca
ctcaacagctcaccacccttggctcctggagagtttgatccaaacattgatgtttatgca
attaaatgccatgagaatgcgcctagaaaagaggtatacttcatggcgattattgacatc
cttactcattacgatgcaaaaaagaaagctgcccacgctgcaaaaactgttaaacatggc
gctggagctgagatctcgactgtgaacccagagcagtattccaagcgctttttggacttt
attgggcacatcttgtaa

DBGET integrated database retrieval system