KEGG   Mus musculus (house mouse): 108096
Entry
108096            CDS       T01002                                 
Symbol
Slco1a5, Oatp-3, Oatp3, Slc21a7
Name
(RefSeq) solute carrier organic anion transporter family, member 1a5
  KO
K03460  solute carrier organic anion transporter family, member 1A
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    108096 (Slco1a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    108096 (Slco1a5)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC21/ASLCO: Organic anion transporter
   108096 (Slco1a5)
SSDB
Motif
Pfam: OATP MFS_1 Kazal_2 Kazal_1 ASFV_L11L
Other DBs
NCBI-GeneID: 108096
NCBI-ProteinID: NP_001254636
MGI: 1351865
Ensembl: ENSMUSG00000063975
UniProt: Q91YY5 A0A0G2JDD1
Position
6:complement(142179953..142268707)
AA seq 670 aa
MGETEKRIATHGVRCFSKIKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGL
INGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGLGCFLMSLPHFLMGRYEYETTIS
PTSNLSSNSFLCMENRTQTLKPTQDPAECVKEMKSLMWIYVLVGNIIRGIGETPIMPLGI
SYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVNTDDLTITPTDTR
WVGAWWIGFLVCAGVNILTSIPFFFFPKTLPKEGLQDNVDRTENDKEEKHREKAKEENRG
ITKDFLPFMKSLSCNPIYMLLILTSVLQINAFINMFTFLPKYLEQQYGKSTSEVVLLIGV
CNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQVAGLTT
SYEGVQHPLYVENKVLADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVGMGTHMV
FQNCSCIQSSGNSSAVLGLCKKGPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLRCIK
SEEKSLGIGLHAFCTRIFAGIPAPIYFGALIDRTCLHWGTLKCGEPGACRMYNINNFRRI
YLVLPAALRGSSYLPAFFILILMRKFQLPGEMYSSETELADMKLTVKKSECTDVHRIPKV
ENDGELKTKL
NT seq 2013 nt   +upstreamnt  +downstreamnt
atgggagaaacagagaaaaggattgcaacccatggggtcagatgcttttctaagatcaag
atgtttctgttggcattaacatgtgcatatgtatccaaatcactctcaggaatttatatg
aattccatgcttacacaaatagagagacaattcgatatccccacatctatagttggactt
atcaatgggagctttgagattggaaatcttttgttgattatactcgtgagttactttgga
acaaaattgcacagacctatcatgattggtattggatgtgtgattatgggcctagggtgt
ttcttaatgtccttacctcatttcctcatgggccgatacgaatatgaaacaacgatttca
cctacaagcaacttgtcctcaaacagcttcttgtgtatggaaaacagaacacagacctta
aagccaacgcaagaccctgcagagtgtgtgaaagaaatgaaatcattaatgtggatatat
gtactggtaggaaacatcatacgtggaattggtgaaactcccatcatgcccttgggtatt
tcctacatagaagattttgccaaatctgaaaactctcctttatatattgggattttagaa
tcaggaaagatgattggcccaattgttggacttttgttgggatccttctgtgcaagaatt
tatgtagacacagggtctgtgaatacagatgacctgaccataactcccactgatacacgc
tgggtcggtgcttggtggattggctttttggtctgtgcaggagtgaatatcctgaccagc
atcccctttttcttctttccaaaaacactcccaaaggaaggattacaggataatgtggat
agaactgaaaatgacaaagaggagaagcacagagaaaaagccaaggaggaaaaccgagga
atcactaaagatttcctgccattcatgaagagcctctcctgcaatcctatttacatgctt
ctcatcctgacaagtgtgctccagataaacgcatttatcaatatgtttaccttcttgccc
aaatacctggagcagcagtatggaaaatccacttcagaggtcgtcctcctcataggtgtt
tgtaacttacctccaatctgcattggatatttacttattggctttattatgaagaagttc
aggattactgtcaagaaggctgcatacatggcattctgcctatccctgtttgagtacctt
ctgtcttactttcactttatgataagctgtgataatttccaagttgctggcttaactacc
tcttatgaaggagttcagcaccctctatatgtggagaacaaggtccttgctgactgcaac
acaaggtgtagctgcttaacaaacacatgggatccagtgtgtggagacaatggcctatca
tacatgtcagcctgcctcgcgggctgtgagaagtctgttggaatgggaacccacatggtg
tttcaaaattgcagctgcattcagtcatcaggaaactcatctgcagtcctggggctgtgt
aaaaaaggccctgagtgtgctaacaagctgcagtactttttaatcatgtcggtaattggc
agtttcatctattcgatcacagccatacctgggtacatggttcttctgaggtgtatcaag
tctgaagagaagtcccttggaattggattacacgcattttgcacaagaatattcgctggc
atccctgcacccatttactttggagctttgatagacagaacctgcttacattggggaact
ctgaaatgtggtgagccaggagcctgtaggatgtacaatataaataacttcaggcgcatt
tatctagtgttgcctgcagcactaagaggatcaagctatctccctgcattcttcattctg
atacttatgaggaaattccagctccctggggaaatgtactcttctgaaactgaacttgca
gacatgaagctcacagtgaagaaaagcgagtgcacagatgtgcacagaattcctaaggtc
gagaatgatggagaactgaaaactaagctgtaa

DBGET integrated database retrieval system