KEGG   Mus musculus (mouse): 108097Help
Entry
108097            CDS       T01002                                 

Gene name
Prkab2, 5730553K21Rik, AW049591, BB124140
Definition
(RefSeq) protein kinase, AMP-activated, beta 2 non-catalytic subunit
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04371  Apelin signaling pathway
mmu04530  Tight junction
mmu04710  Circadian rhythm
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    108097 (Prkab2)
   04068 FoxO signaling pathway
    108097 (Prkab2)
   04152 AMPK signaling pathway
    108097 (Prkab2)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    108097 (Prkab2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    108097 (Prkab2)
   04922 Glucagon signaling pathway
    108097 (Prkab2)
   04920 Adipocytokine signaling pathway
    108097 (Prkab2)
   04921 Oxytocin signaling pathway
    108097 (Prkab2)
  Aging
   04211 Longevity regulating pathway - mammal
    108097 (Prkab2)
   04213 Longevity regulating pathway - multiple species
    108097 (Prkab2)
  Environmental adaptation
   04710 Circadian rhythm
    108097 (Prkab2)
   04714 Thermogenesis
    108097 (Prkab2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    108097 (Prkab2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    108097 (Prkab2)
   04931 Insulin resistance
    108097 (Prkab2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Motif
Other DBs
NCBI-GeneID: 108097
NCBI-ProteinID: NP_892042
MGI: 1336185
Ensembl: ENSMUSG00000038205
Vega: OTTMUSG00000029934
UniProt: Q6PAM0
Position
3; 3 F2.2
AA seq 271 aa AA seqDB search
MGNTTSERVSGERHGAKAARAEGGGHGPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVP
WQQDLDDSVKPAQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEG
EHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDL
SSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHL
YALSIKDSVMVLSATHRYKKKYVTTLLYKPI
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacactaccagcgagcgggtgtccggggagcgccacggagccaaagctgctcga
gctgagggcggcggccatggcccgggaaaggagcacaagatcatggtggggagcacggac
gaccccagcgtcttcagcctgcccgactccaagctccccggggacaaagagtttgtaccc
tggcagcaggatttggatgattctgtgaagcccgcccagcaggcccggcccaccgttatc
cgctggtctgaaggaggcaaggaggtcttcatctctgggtccttcaacaattggagcacc
aagatccctctgataaagagtcataatgacttcgttgccatcctggatcttccagaggga
gagcatcagtacaagttctttgtggacggacagtgggttcatgatccgtcagagcctgtg
gttaccagtcagcttggaacaattaataacttgatccacgtcaagaaatctgattttgaa
gtatttgacgctttaaagttagactctatggaaagctcggagacgtcatgtcgagacctg
tccagctcaccccctgggccttacggtcaagaaatgtatgtgtttcgatctgaggagaga
ttcaaatccccacccatcctgccccctcacctactccaagttattcttaacaaggacacg
aatatttcatgtgacccagccttacttcctgagcccaatcatgttatgctgaaccatctc
tatgcactgtccattaaggacagtgtgatggtccttagcgcaacccatcgctacaagaag
aagtatgtcaccacgctgctgtataagcccatctga

DBGET integrated database retrieval system