KEGG   Mus musculus (mouse): 108101Help
Entry
108101            CDS       T01002                                 

Gene name
Fermt3, C79673, Kindlin3
Definition
(RefSeq) fermitin family member 3
  KO
K17084  kindlin 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108101 (Fermt3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    108101 (Fermt3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108101 (Fermt3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FERM_M Kindlin_2_N PH PH_17 FERM_N PH_11 PH_8
Motif
Other DBs
NCBI-GeneID: 108101
NCBI-ProteinID: NP_722490
MGI: 2147790
Ensembl: ENSMUSG00000024965
UniProt: Q8K1B8 Q3TEE6
Structure
PDB: 

Position
19; 19 A
AA seq 665 aa AA seqDB search
MAGMKTASGDYIDSSWELRVFVGEEDPEAQSVTLRVTGESHIGGVLLKIVEEINRKQDWS
DHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRVLRLRASFSKPL
FQTVAAICRLLSIRHPEELSLLRAPEKKEKKKKEKEPEEEVHDLTKVVLAGGVAPTLFRG
MPAHFSDSAQTEACYHMLSRPQPAPDPLLLQRLPRPSSLPDKTQLHSRWLDSSRCLMQQG
IKAGDVLWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLTEEIDCTEEEMMVFAALQYH
INKLTLSGDVGELASGDLGLDDLDAALNNLEVKLKGSAPSDMLDSLTTIPELKDHLRIFR
PRKLTLKGYRQYWVVFKDTTLSYYKSQDEAPGDPTQQLNLKGCEVVPDVNVSGQKFCIKL
LVPSPEGMSEIYLRCQDEQQYAQWMAACRLASKGRTMADSSYASEVQAILAFLSLQRAGG
SNGGSGNKPQGPEAPAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLTEAQLR
FIQAWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNV
NWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTG
GHEAF
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtatgaagacagcctccggggactatatcgactcttcctgggagctgagggtg
tttgtgggcgaggaggaccctgaggcccagtctgtcacactccgagtcacgggggagtcg
cacattggtggggtacttctgaagatcgtggaggaaatcaatcgcaagcaggactggtct
gaccatgccatttggtgggagcagaagagacagtggctgctgcagacacactggacgctg
gacaagtacgggattctggccgatgcccgcctcttctttgggccacagcaccgacctgtc
atcctgcgactgcccaacagacgtgtgctgcggcttcgggccagtttctccaagcccctc
ttccaaacggtggctgccatctgccgcctcctcagtatcaggcacccagaggagctgtct
ctgctgcgtgctccagagaagaaggagaagaagaagaaggagaaggagcctgaagaggag
gtgcatgacctgacaaaggttgtcttagctggcggtgtggcacccactttattcagaggc
atgccagcacacttctcggacagcgcccagactgaggcttgttaccacatgctgagccgg
ccacagccggcacctgaccctctcctgctccagcgcctgccaaggcccagctccctgcct
gacaagacccagctccacagcaggtggctggattcatctcggtgcctcatgcagcaaggt
atcaaggccggggatgtgctttggctgcgatttaagtactacagcttttttgacctggat
cccaagacagaccctgtgcggctgacccagctgtatgagcaggcccgctgggacttactg
acagaggagatcgactgcactgaagaagagatgatggtgtttgctgccctgcagtaccac
atcaacaaactgaccctgagcggggatgtgggtgagctggcctctggggacctgggactg
gatgacctggatgcagccctgaacaacctggaggtgaagctgaaggggtcagcaccctca
gacatgctggatagtctcactaccatcccagaactcaaggaccatctccggatcttccgg
ccccggaagctgaccctgaagggctaccgccagtactgggtggtatttaaggacaccaca
ctgtcctactataagagccaagatgaagcaccgggggaccctacccagcagctcaacctc
aagggctgtgaggtggtccctgatgtcaatgtctctggccagaagttctgcatcaaactc
ctggtaccctcaccagagggcatgagtgagatctacctgaggtgccaggatgaacagcag
tacgcacagtggatggctgcctgccgactggcctccaagggccgcaccatggcggacagc
agctatgccagcgaggtgcaggccattctggccttcctcagcctgcagcgggcaggtggt
agcaatggaggctcagggaacaaacctcaaggtcctgaagcccctgctgagggccttaac
ccctatggcctcgtggctcctcggttccagcgaaagttcaaggccaagcagctcacccca
aggatcctggaagctcaccaaaacgtggcccaactctcactgaccgaggcccagctgcgc
tttatccaggcctggcaatccttgcccgactttggcatctcctatgtgatggtcaggttc
aagggcagcaggaaagatgagatcctaggcattgccaacaaccgactcatccggattgat
ctggccgtgggtgacgtggtcaagacctggcgcttcagcaacatgcggcaatggaacgtc
aactgggacatacggcaggtggccattgagttcgatgaacacatcaatgtggccttcagc
tgtgtgtctgctagctgccgcatcgtgcacgagtacatcgggggttacatcttcctgtcc
acccgagagcgggcccgaggggaagagctggatgaggatctgttcctgcagcttacagga
ggccatgaggccttctga

DBGET integrated database retrieval system