KEGG   Mus musculus (mouse): 108105
Entry
108105            CDS       T01002                                 

Symbol
B3gnt5, beta3GnT5
Name
(RefSeq) UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5
  KO
K03766  beta-1,3-N-acetylglucosaminyltransferase 5 [EC:2.4.1.206]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00601  Glycosphingolipid biosynthesis - lacto and neolacto series
mmu01100  Metabolic pathways
Module
mmu_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
mmu_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    108105 (B3gnt5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    108105 (B3gnt5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.206  lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
     108105 (B3gnt5)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   108105 (B3gnt5)
SSDB
Motif
Pfam: Galactosyl_T Fringe
Other DBs
NCBI-GeneID: 108105
NCBI-ProteinID: NP_001152879
MGI: 2137302
Ensembl: ENSMUSG00000022686
Vega: OTTMUSG00000026282
UniProt: Q8BGY6
Position
16; 16 A3
AA seq 376 aa
MRLFVSRRVKRWKIFHFFVTCFILSFMVFWSPINNYIMSHMKSYSYRYLVNSYGFVNNSL
SLKHSSVQPHYPYLINHREKCQAQDVLLLLFIKTAPENYGRRSAIRKTWGNENYVQSQLN
ANIKILFALGTPGPLKGKELQKRLIGEDQVYKDIIQQDFIDSFHNLTSKFLLQFSWANTF
CPHAKFLMTADDDIFIHMPNLIEYLQGLEQIGVRDFWIGHVHRGGPPVRDKSSKYYVPYE
MYKWPAYPDYTAGAAYVVSRDVAAKIYEASQTLNSSMYIDDVFMGLCANKVGILPQDHVF
FSGEGKIPYHPCIYEKMMTSHGHLQDLQDLWIEATHPKVKNISKGFFGQIYCRLIKIVLL
CRLTYRNSYPCWAAFA
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgagactgtttgttagcagaagagtcaaaagatggaaaatttttcacttttttgtcact
tgttttatattaagcttcatggttttttggagcccaatcaataattacatcatgagccat
atgaagtcctactcctacagatacctcgtaaatagctatggctttgtaaacaattccctg
tctctcaagcacagctctgtgcagcctcactacccatacttgatcaaccacagagagaag
tgtcaggctcaagatgtcctcctcttactgtttataaagactgcccctgaaaactatggc
cgacgttctgcaatcagaaaaacgtggggcaatgagaactatgttcagtctcaactcaat
gccaacatcaaaattctgtttgcattaggaactcctggtccactgaagggaaaagaactg
caaaaaagactaatcggggaagatcaagtgtacaaggatataattcagcaagatttcatt
gattctttccacaatcttacttctaaattccttcttcagttcagctgggcaaataccttt
tgtccacatgccaaattcctgatgactgctgatgatgatatatttatccacatgccaaat
ctcattgaatatcttcaagggctagagcagattggagttcgagacttttggattggtcac
gttcatcgaggtggccctcctgttagggataaaagcagcaaatactatgttccctatgaa
atgtacaagtggccagcctaccctgactatacagctggtgctgcctatgttgtctccaga
gatgtagctgccaaaatctatgaggcatcgcagacactgaattccagtatgtacatagat
gatgtattcatgggcctctgtgccaataaagtgggaatcttgccacaggaccatgtattt
ttctctggggaagggaaaattccttatcacccctgcatctatgaaaagatgatgacatct
cacggacacttacaagatctgcaggacctctggatagaggctacacatcctaaagtaaag
aacatttcaaaagggttttttggtcaaatatactgcaggttaattaagatagttcttctc
tgcagactgacttacaggaattcatacccttgttgggctgcatttgcttag

DBGET integrated database retrieval system