KEGG   Mus musculus (mouse): 108112
Entry
108112            CDS       T01002                                 

Gene name
Eif4ebp3, 4e-bp3
Definition
(RefSeq) eukaryotic translation initiation factor 4E binding protein 3
  KO
K18645  eukaryotic translation initiation factor 4E binding protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    108112 (Eif4ebp3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    108112 (Eif4ebp3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     108112 (Eif4ebp3)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 108112
NCBI-ProteinID: NP_957708
MGI: 1270847
Ensembl: ENSMUSG00000090264
Vega: OTTMUSG00000033201
UniProt: Q80VV3
Position
18; 18 B2
AA seq 101 aa
MSSSTSCPIPGCRDQLPDGYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCC
LPQIPGVTTLPAVPPSKLELLKEQKQTEVEITDDEQFEMDM
NT seq 306 nt   +upstreamnt  +downstreamnt
atgtcctcgtccacgagttgcccaattccagggtgccgggaccagctgccagacggctac
agcaccacgcctggcggcacactatacgccactaccccgggaggcaccaggatcatctac
gacagaaagttcctgctggagtgcaagaactcacccattgcccggacacctccctgctgc
ctccctcagattcccggggtcacaactctcccagcagtaccaccctccaagttggagttg
ctgaaggaacagaagcagacagaggtagaaataaccgatgacgaacagtttgaaatggac
atgtaa

DBGET integrated database retrieval system