KEGG   Mus musculus (mouse): 108116
Entry
108116            CDS       T01002                                 

Gene name
Slco3a1, 5830414C08Rik, Anr1, MJAM, OATP-D, R75096, Slc21a11
Definition
(RefSeq) solute carrier organic anion transporter family, member 3a1
  KO
K14353  solute carrier organic anion transporter family, member 3A
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    108116 (Slco3a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC21/ASLCO: Organic anion transporter
   108116 (Slco3a1)
SSDB
Motif
Pfam: OATP MFS_1 Kazal_2 MFS_1_like Kazal_1 D_CNTX PUCC
Other DBs
NCBI-GeneID: 108116
NCBI-ProteinID: NP_076397
MGI: 1351867
Ensembl: ENSMUSG00000025790
Vega: OTTMUSG00000024304
UniProt: Q8R3L5
Position
7; 7 D1
AA seq 710 aa
MQGKKPGGSSGGGRSGELQGDEAQRNKKKKKKVSCFSNIKIFLVSECALMLAQGTVGAYL
VSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMALGA
LLSALPEFLTHQYKYEAGEIRWGAEGRDVCATNGSSSDEGPDPDLICRNRTATNMMYLLL
IGAQVLLGIGATPVQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIY
VDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSLLMFGFPQSLPPHSDPGMESE
QAMLPEREYERPKPSNGVLRHPLEPDSSASCFQQLRVIPKVTKHLLSNPVFTCIVLAACM
EIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGA
IRMAMLVNLVSTACYVSFLFLGCDTGPVAGVTVRYGNNSARGSALDPYSPCNNNCECQTD
SFTPVCGADGITYLSACFAGCNSTNLTGCACLTTVPPENASVVPGKCPSPGCQEAFLTFL
CVMCVCSLIGAMAQTPSVIILIRTVSPELKSYALGVLFLLLRLLGFIPPPLIFGAGIDST
CLFWSTFCGEQGACVLYDNVVYRYLYVSIAIALKSFAFILYTTTWQCLRKNYKRYIKNHE
GGLSTSEFFASTLTLDNLGRDPVPAHQTHRTKFIYNLEDHEWCENMESVL
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgcagggaaagaagccgggcggctcgtcgggcggcggccggagcggcgagctgcagggg
gacgaggcgcagaggaacaagaagaagaaaaagaaggtgtcctgcttctccaacatcaag
atcttcctggtgtctgagtgcgccttgatgctggcgcagggtacggtgggcgcctacctg
gtgagcgtgttgaccaccctggaacgcaggttcaacctccagagcgccgatgtgggtgtg
atcgccagcagctttgagatcggcaacctggcgctgattctcttcgtaagttacttcgga
gcacgtgggcaccgaccgcgcctcatcggctgtggtggaattgtcatggcactgggcgcc
ctgctttcggcactgcctgagttcctcacccaccagtacaagtacgaggctggcgagatc
cgatggggagcagaaggccgcgatgtctgtgccaccaatgggtccagcagtgatgagggg
cccgacccggacctaatctgccgtaaccggacagccacgaacatgatgtacttgctgctt
attggggctcaggtgctcctgggcatcggtgctacccccgtgcagcccctgggggtctcc
tatattgacgaccacgtgcggagaaaggactcctcgctctacataggaatcctgttcacg
atgttggtatttggaccagcctgtggatttattctgggctctttctgtaccaagatctat
gtggatgcggtcttcattgacacaagtaacctggacatcactccagatgacccgcgttgg
atcggagcctggtggggcggctttctgctctgcggtgccttgctcttcttctcgtccctc
ctgatgtttgggttcccacaatccctgcccccacactcagaccccggcatggagagtgag
caggccatgctcccagaaagagaatatgagaggcccaagcccagcaatggggtcctgaga
caccctctggagccagacagcagtgcctcctgtttccagcaactgagagtgatccccaag
gtcaccaagcacctgctctcaaaccctgtgttcacctgcatcgtcctggctgcttgcatg
gagattgctgtggtggctggcttcgctgccttcctcggcaagtacctggaacagcagttt
aacctcaccacttcctctgccaaccagctgctcgggatgacggcgatcccctgtgcctgc
ctgggcatctttctgggtggccttttggtgaagaagctgagcctgtctgccctgggggcc
attcgaatggccatgctggtcaacctggtgtccacagcctgctacgtctccttcctcttc
ctgggctgtgacacaggccctgtggctggggtcactgttcgctacggaaacaactcagca
cgtggctcggcccttgacccttactctccgtgcaacaacaactgtgaatgccagacggac
tccttcacgccagtgtgcggggccgatggcatcacctacctgtcagcctgcttcgccgga
tgcaacagcacgaacctcacaggctgtgcgtgcctcaccactgtcccccctgagaatgcc
agcgtggttccaggaaaatgtcccagtcctgggtgccaagaggccttcctcaccttcctc
tgtgtgatgtgtgtgtgcagcttgatcggggccatggcccaaaccccttctgtcatcatc
ctcatcaggacagtcagccctgaactcaagtcttatgcgctgggagttctttttctgctc
cttcgtttgttgggtttcatccccccacctctcatcttcggggccggcattgactccacc
tgtctgttctggagcaccttctgcggggaacaaggcgcctgtgtcctctacgacaatgtg
gtctacagatacctgtacgtcagcatcgccattgcgctcaagtcctttgccttcatcctc
tacaccaccacgtggcagtgcctgcggaaaaactataaacgctacatcaaaaaccacgag
ggcgggctgagcaccagtgagttctttgcctctactctgaccctagacaatctggggagg
gaccctgtgcccgcacaccagacacataggacaaaatttatctataacctggaagaccat
gagtggtgtgaaaacatggaatctgttttatag

DBGET integrated database retrieval system