KEGG   Mus musculus (mouse): 108121Help
Entry
108121            CDS       T01002                                 

Gene name
U2af1, 2010107D16Rik
Definition
(RefSeq) U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 1
  KO
K12836  splicing factor U2AF 35 kDa subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108121 (U2af1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    108121 (U2af1)
Spliceosome [BR:mmu03041]
 Complex A
  U2 snRNP components
   U2 related factors
    108121 (U2af1)
 Complex B
    108121 (U2af1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCCH RRM_1 Torus KMP11 Nup35_RRM_2 zf-CCCH_3
Motif
Other DBs
NCBI-GeneID: 108121
NCBI-ProteinID: NP_001157241
MGI: 98884
Ensembl: ENSMUSG00000061613
UniProt: Q9D883 G3UW94
Position
17; 17 B1
AA seq 239 aa AA seqDB search
MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ
TADGSHCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE
EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE
LRRELYGRRRKKHRSRSRSRERRSRSRDRGRGGGGGGGGGGGRERDRRRSRDRERSGRF
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcggaatacttggcctccatcttcggcaccgaaaaagacaaagtcaactgttcattt
tatttcaaaatcggagcatgtcgtcatggagacagatgttctcggttgcacaataaacca
acctttagccagaccatcttgattcaaaacatctatcgtaatccccaaaacagtgcacag
acggctgacggctcacactgtgctgtgagcgacgtggagatgcaggagcactatgatgag
ttctttgaggaagtcttcactgagatggaagagaagtacggggaagtcgaggagatgaac
gtctgcgacaacctaggggaccacctggtggggaacgtgtatgtcaagtttcgacgtgag
gaggatgcagagaaagccgtgatcgacttgaataaccgttggtttaatggacagccgatc
catgcagagctgtccccagtaactgacttcagggaagcctgctgccgccagtatgaaatg
ggagagtgcacaagagggggcttctgcaacttcatgcatttgaagcccatctcaagagag
ctacgacgggagctgtatgggcgccggcgcaagaagcatagatccaggtcccgatccagg
gaacggcgttcccgatccagagaccgtggacgcggtggtggaggtggaggtggaggtggc
ggaggacgggagcgtgacaggaggcggtcaagagaccgggagagatctggacgattctga

DBGET integrated database retrieval system