KEGG   Mus musculus (mouse): 108124
Entry
108124            CDS       T01002                                 

Symbol
Napa, 1500039N14Rik, AW209189, RA, RA81, S, SNAP-alpha, SNAPA, SNARE, a, a-SNAP, hyh
Name
(RefSeq) N-ethylmaleimide sensitive fusion protein attachment protein alpha
  KO
K15296  alpha-soluble NSF attachment protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    108124 (Napa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    108124 (Napa)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Others
    108124 (Napa)
SSDB
Motif
Pfam: SNAP TPR_12 TPR_7 Spatacsin_C RIG-I_C
Other DBs
NCBI-GeneID: 108124
NCBI-ProteinID: NP_080174
MGI: 104563
Ensembl: ENSMUSG00000006024
Vega: OTTMUSG00000023922
UniProt: Q9DB05
Position
7 A2; 7 8.74 cM
AA seq 295 aa
MDNSGKQAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSA
AGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIA
AKHHISIAEIYETELVDVEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAAQLEQYQK
AIDIYEQVGTSAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRE
CKLMKKLLEAHEEQNVDSYTEAVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR
NT seq 888 nt   +upstreamnt  +downstreamnt
atggacaactccgggaagcaggctgaggctatggcgctgctggctgaagcggagcgcaag
gtgaagaactcgcagtccttcttctccggcctctttggaggctcatccaaaatagaggaa
gcatgcgagatctatgccagagcggcgaacatgttcaagatggccaagaactggagcgct
gctgggaacgctttctgccaggctgcccaactacacctacagctccaaagcaagcacgat
gcagccacctgctttgtggacgctggcaatgctttcaagaaagctgacccccaagaggcc
attaactgtctgatgagagcaattgagatctatacagacatgggcagattcacaatcgca
gccaagcaccacatctccatcgctgagatctatgagacagaactggtggatgtagagaag
gccatcgcccactatgagcaatctgcagactactacaaaggagaagagtccaacagctca
gccaacaagtgtctgctgaaggtggctggctacgccgcacagctggagcagtaccagaag
gctatcgacatctatgagcaggtggggaccagtgccatggacagtcccctcctcaagtac
agcgccaaagactacttcttcaaggcggccctctgccacttctgcattgacatgctcaac
gccaagctcgctgttcagaagtatgaggagctcttcccggccttctcggattcccgggaa
tgcaagctgatgaaaaagctgctggaagcccatgaggaacagaatgtggacagctacaca
gaggcggtgaaggaatatgactccatctccagactggaccagtggcttaccaccatgctt
ctgcgcataaagaagaccattcagggtgacgaggaggacctgcgctag

DBGET integrated database retrieval system