KEGG   Mus musculus (house mouse): 108147
Entry
108147            CDS       T01002                                 
Symbol
Atic, 2610509C24Rik, AA536954, AW212393
Name
(RefSeq) 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00230  Purine metabolism
mmu00670  One carbon pool by folate
mmu01100  Metabolic pathways
mmu01523  Antifolate resistance
Module
mmu_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108147 (Atic)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    108147 (Atic)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    108147 (Atic)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    108147 (Atic)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     108147 (Atic)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     108147 (Atic)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108147 (Atic)
SSDB
Motif
Pfam: AICARFT_IMPCHas MGS
Other DBs
NCBI-GeneID: 108147
NCBI-ProteinID: NP_080471
MGI: 1351352
Ensembl: ENSMUSG00000026192
UniProt: Q9CWJ9
Position
1:71596315..71618562
AA seq 592 aa
MAPSQLALFSVSDKTGLVEFARSLASLGLSLVASGGTAKAIRDAGLAVRDVSELTGFPEM
LGGRVKTLHPAVHAGILARNIPEDAADMARLDFNLVRVVVCNLYPFVKTVASPDVTVEAA
VEQIDIGGVTLLRAAAKNHARVTVVCEPEDYAGVAAEMHGSDSKDTSLETRRHLALKAFT
HTAQYDEAISDYFRKQYSKGISQMPLRYGMNPHQTPAQLYTLKPKLPITVLNGAPGFINL
CDALNAWQLVTELRGAVDIPAAASFKHVSPAGAAVGVPLSEDEARVCMVYDLYPTLTPLA
VAYARARGADRMSSFGDFVALSDICDVPTAKIISREVSDGIVAPGYEEEALKILSKKKNG
NYCVLQMDQSYKPDENEVRTLFGLRLSQKRNNGVVDKSLFSNIVTKNKDLPESALRDLIV
ATVAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKA
GVKRAEISNAIDQYVTGTIGEGEDLVKWEALFEEVPELLTEAEKKEWVDKLSGVSVSSDA
FFPFRDNVDRAKRSGVAYIVAPSGSTADKVVIEACDELGIVLAHTDLRLFHH
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggctccgtctcagcttgccctgttcagtgtgtctgacaaaactggcctcgtggaattt
gccagaagtctcgcgtctcttggtttgagtctggtcgcttccggaggcacggcaaaagcg
atcagggatgctggcctggcagtcagagatgtgtctgagctaacagggttccctgaaatg
ttagggggacgcgtgaaaaccttgcaccctgcggtccatgctgggatcttggcacgcaac
attccagaagacgctgcagacatggccaggcttgatttcaaccttgtaagggttgtggtc
tgtaacctgtaccccttcgtgaagactgtggcttctccagatgtaactgttgaggcagct
gttgaacaaattgatattggtggcgtgacattactgagagctgcagccaaaaaccacgct
cgagtgacagtcgtctgtgaaccagaggactatgcgggggtagctgcagagatgcacggc
tctgatagtaaggacacctccctagagaccaggcgccacttggccttgaaggcattcact
cataccgctcaatacgatgaagcaatttcagattacttcaggaaacagtacagtaaggga
atttctcagatgcccttgcggtatgggatgaacccccatcagactcctgcccagttgtat
acgctgaagcccaaacttcccatcacagttctcaatggagccccaggattcataaacttg
tgtgacgctttgaacgcctggcagctggtgacagagctgagaggagcagtagacatccca
gcggctgcttctttcaagcacgtcagcccggcaggtgctgctgttggggttccactcagt
gaggacgaggccagagtctgcatggtctatgacctctacccgaccctcacgcccctggcc
gttgcatatgcaagagcaagaggagctgataggatgtcttcatttggtgattttgttgca
ttgtctgacatttgtgatgtcccaactgcaaaaattatctccagagaagtgtcggatggt
attgttgccccgggatatgaagaagaagccttgaaaatactttctaaaaagaaaaatgga
aactactgtgttcttcagatggaccagtcctacaaaccagatgaaaatgaagttcgaaca
ctctttggtcttcgtttaagccagaagagaaataatggtgtcgttgacaagtcattattt
agcaatattgtcaccaagaataaagatctgccggagtctgcactcagagacctcattgtc
gccaccgtcgctgtcaagtatactcagtctaattcggtgtgctatgccaaggatgggcag
gttattggcatcggagcaggacagcagtctcggatacactgcactcgccttgcaggtgat
aaggcaaactcttggtggcttcggcaccacccacgagtgctgtccatgaagtttaaagcc
ggggtgaagagagcagagatctccaatgcgattgatcagtatgtgaccggcactatcggt
gagggcgaagacctggtgaaatgggaagcactgttcgaagaggttcctgagttactcacg
gaggcggagaagaaggaatgggtggacaagctgagcggcgtgtctgtcagctccgacgcc
ttctttcctttcagggataatgtggaccgagctaaaaggagtggtgtggcctacattgtc
gctccatctggatctactgctgacaaggttgtgattgaggcgtgcgacgagctggggatt
gtcttggctcatacggatctccggctcttccaccactga

DBGET integrated database retrieval system