KEGG   Mus musculus (house mouse): 108150
Entry
108150            CDS       T01002                                 
Symbol
Galnt7, AI225872
Name
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 7
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00512  Mucin type O-glycan biosynthesis
mmu00514  Other types of O-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    108150 (Galnt7)
   00514 Other types of O-glycan biosynthesis
    108150 (Galnt7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    108150 (Galnt7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     108150 (Galnt7)
Glycosyltransferases [BR:mmu01003]
 O-Glycan biosynthesis
  Mucin-type
   108150 (Galnt7)
SSDB
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Other DBs
NCBI-GeneID: 108150
NCBI-ProteinID: NP_001161453
MGI: 1349449
Ensembl: ENSMUSG00000031608
UniProt: Q80VA0 Q3U8I4
Position
8:complement(57976859..58106089)
AA seq 657 aa
MRLKIGFILRSLLVVGSFLGLVVLWSSLSSRPDDQSPLSRMREDRDVNNPLPNRGGNGLA
PGDDRFKPVVPWPHVEGVEVDLESIRRKNKAKNEQERHAGGDSQRDVMQRQYLTFKPQTF
TYRDPVLRPGVLGNFEPKEPEPHGVVGGPGEKAKPLVLGPEYKQAVQASIKEFGFNMVAS
DMISLDRSVNDLRQEECKYWHYDENLLTSSVVIVFHNEGWSTLMRTVHSVIKRTPRKYLA
EIVLIDDFSNKEHLKEKLDEYIKLWNGLVKVFRNERREGLIQARSIGAQKAKLGQVLIYL
DAHCEVAVNWYAPLVAPISKDRATCTVPLIDYIDGNDYSIEPQQGGDEDGFARGAWDWSM
LWKRIPLSHKEKAKRKHKTEPYRSPAMAGGLFAIEKDFFFELGLYDPGLQIWGGENFEIS
YKIWQCGGKLLFVPCSRVGHIYRLEGWQGNPPPLYVGSSPTLKNYVRVVEVWWDEYKDYF
YASRPESKALPYGDISELKKFREDHNCKSFKWFMEEIAYDITAHYPLPPRNVEWGEIRGL
ETAYCIDSMGKTNGGFVELGPCHRMGGNQLFRINEANQLMQYDQCLTKGPDGSKVMITHC
NLNEFKEWQYFKSLHRFTHITSGKCLDRSEVLHQVFISTCDSSKMTQKWEMNNIHSV
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgaggctgaagatcgggttcatcttacgcagtttgctggtggtgggaagcttcctgggg
ctcgtggtcctctggtcttccctgtcctcgcggcccgacgaccagagcccactgagcagg
atgagggaagacagagatgtcaataaccccttgcctaaccgaggaggcaatggactagct
cctggagatgacagattcaaacctgtggtaccatggcctcatgttgaaggagtagaagtg
gacttagagtctattagaagaaaaaacaaagccaaaaatgaacaggagcgccatgctgga
ggagattcccagagagacgtaatgcagaggcagtaccttacatttaagcctcagaccttc
acctaccgtgatcctgtgctacgcccaggggtcctcgggaactttgaacccaaagaaccc
gagcctcacggagtggttggtggccctggagagaaagccaagccattggttctgggacca
gaatacaaacaagcagttcaagccagcattaaggagtttggatttaacatggtggcaagt
gacatgatctcactggaccgcagcgtcaatgacttacgccaagaagaatgcaagtattgg
cactatgatgaaaacctgcttacttcaagcgttgtcattgtcttccataatgaaggatgg
tcaaccctcatgaggacagtccacagtgtaatcaaaaggacaccaaggaagtacttagca
gaaatcgtgttaattgatgacttcagcaataaagaacacttaaaagagaaactggatgag
tatataaagctatggaatggcctcgtgaaggtatttcgaaatgagagaagagagggtttg
attcaagctcggagcattggcgcacagaaggctaaactcggacaggttttgatatacctt
gatgcccactgtgaggtggcagttaactggtatgctccacttgtagcccccatatctaag
gacagagctacatgtactgtgcctctaatagattacatagacgggaatgattattccatt
gaaccacagcaaggtggggatgaagatggttttgccagaggggcctgggactggagtatg
ctatggaaacgtatcccactaagccacaaggaaaaggccaaaagaaagcataaaactgag
ccttatcggtctccagctatggcgggtggattgtttgccatagagaaggacttcttcttc
gaactgggtctctatgatcctggtctccagatctggggtggtgaaaactttgaaatttca
tacaagatctggcagtgcggtggcaaattgttatttgtgccttgttctcgtgttgggcac
atctaccgtcttgagggctggcaaggaaaccccccacccctttacgttggctcctctcca
actctgaagaattatgttagagtcgtggaagtctggtgggatgaatataaagactacttc
tatgctagccgtcctgagtcaaaggcgctgccctacggggacatatctgagctgaagaaa
tttcgagaagatcacaactgcaaaagtttcaagtggtttatggaagaaatcgcttatgac
atcactgcccactaccctttgccccccagaaatgtcgagtggggtgaaatccgaggcctc
gaaactgcatactgtattgatagcatggggaagacgaatggaggcttcgtggagctagga
ccctgccacaggatgggtgggaaccagcttttccgaatcaatgaagcaaaccagctcatg
cagtacgaccagtgtttgacaaaggggcctgatggatccaaagtcatgatcacacactgt
aacctaaatgaatttaaggaatggcagtacttcaagagcctgcacaggtttacgcacatc
acttccggaaagtgcttagatcgatcggaggtcctgcatcaagtgttcatctccacctgt
gactccagtaaaatgactcagaagtgggagatgaataacatccacagtgtttga

DBGET integrated database retrieval system