KEGG   Mus musculus (mouse): 108154Help
Entry
108154            CDS       T01002                                 

Gene name
Adamts6, A930019D11Rik, ADAM-TS6, b2b1879.1Clo, b2b2029Clo, b2b2182Clo, b2b2187.1Clo, b2b2228Clo
Definition
(RefSeq) a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6
  KO
K08621  a disintegrin and metalloproteinase with thrombospondin motifs 6 [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    108154 (Adamts6)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     108154 (Adamts6)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   108154 (Adamts6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pep_M12B_propep ADAM_spacer1 Reprolysin TSP_1 ADAM_CR_2 Reprolysin_5 Reprolysin_3 PLAC Reprolysin_2 Reprolysin_4 Peptidase_M57
Motif
Other DBs
NCBI-GeneID: 108154
NCBI-ProteinID: NP_001074489
MGI: 1347348
Ensembl: ENSMUSG00000046169
UniProt: D3Z1A5
Position
13; 13 D1
AA seq 1117 aa AA seqDB search
MEISWKTLTWILSLIMASSEFYSDHRLSYSSQEEFLTYLEHYQLTIPIRVDQNGAFLSFT
VKNDKHSRRRRSMDLLDPQQAVSKLFFKLSAYGKHFHLNLTLNTNFVSKHFTVEYWGKDG
PQWKHDFLDNCHYTGYLQDQHSTTKVALSNCVGLHGIIATEDEEYFIEPLKNTTEDSKHF
SYENGHPHVIYKKSTLQQQHIYDHSHCGVSDLTGSGKPWWLNKTSSFPSLPPINDTHIHH
RKRRSVSTERFVETLVVADKMMVGYHGRKDIEHYILSVMNIVAKLYRDSSLGNVVNIIVA
RLIVLTEDQPNLEINHHADKSLDSFCKWQKSILSHQSDGNTIPENGIAHHDNAVLITRYD
ICTYKNKPCGTLGLASVAGMCEPERSCSINEDIGLGSAFTIAHEIGHNFGMNHDGIGNSC
GTKGHEAAKLMAAHITANTNPFSWSACSRDYITSFLDSGRGTCLDNEPPKRDFLYPAVAP
GQVYDADEQCRFQYGATSRQCKYGEVCRELWCLSKSNRCVTNSIPAAEGTLCQTGNIEKG
WCYQGDCVPFGTWPQSIDGGWGSWSLWGECSRTCGGGVSSSLRHCDSPAPSGGGKYCLGE
RKRYRSCNTDPCPLGSRDFREKQCADFDSMPFRGKHYNWKPYTGGGVKPCALNCLAEGYN
FYTERAPAVIDGTQCNADSLDICINGECKHVGCDNILGSDAREDRCRVCGGDGSTCDAIE
GFFNDSLPRGGYMEVVQIPRGSVHIEVREVSMSKNYIALKSEGDDYYINGAWTIDWPRKF
DVSGTAFHYKRPTDEPESLEALGPTSENLIVMVLLQEQNLGIRYKFNVPIVRTGSGDNEV
GFMWTYQPWAECSATCAGGVQRQEVVCKRLDDNSIVQNNFCDPDSKPPENQRACNTEPCP
PEWFIGDWLECSKTCDGGMRTRAVLCIRKVGPSEEETLDYGDCLTHRPVEKESCNNQSCP
PQWVALDWSECTPKCGSGFKHRIVLCKSSDLSKTFPAAQCPEESKPPARIRCSLGRCPPP
RWVTGDWGQCSAQCGLGQQMRTVQCLSYTGQASVDCPETVRPPSMQQCDSKCDSTPLSST
EECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTCQGH
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttcgtggaaaacgttgacttggattctgagcctcatcatggcctcatcggaa
ttttatagtgaccacagactttcatatagttctcaagaggaattcctgacttatcttgaa
cactaccagctaactattccaataagagttgaccaaaatggagcttttctcagctttact
gtgaaaaatgataaacactcaagaagaagacggagtatggaccttcttgatccacagcag
gcagtgtctaaattattttttaaactttcagcctatggcaagcactttcacctaaacttg
actctcaatacaaattttgtgtccaaacattttacagtagagtattgggggaaagatgga
ccccagtggaaacatgattttttagacaactgtcactacacaggatacttgcaagatcaa
catagtacaactaaagtggctttaagcaactgtgttggattgcatggtattattgctaca
gaagatgaagaatattttattgagcctctaaagaatactacagaggattccaaacatttt
agttatgaaaatggccatcctcatgttatttacaaaaagtctactcttcagcaacaacat
atctatgatcattctcattgtggggtttcagatctcacaggaagtggcaaaccttggtgg
ctgaataagacatcatcttttccttctttaccaccaattaatgacacacatattcatcac
agaaagagaagatctgtgagcactgagagatttgtggagactttagtagtggcagacaaa
atgatggtgggctaccatggccgtaaagacattgaacattatattttaagtgtgatgaat
attgttgccaaactttatcgtgactccagtctaggaaacgttgtgaatattatagtggct
cgcttaattgttctcactgaagatcagccaaacttggagataaaccatcatgcagacaag
tccctcgatagcttctgtaaatggcagaaatccattctctcccaccaaagtgatggaaac
accattccagaaaatgggattgcccaccacgataatgcagttcttattactagatatgat
atctgcacgtataaaaacaagccctgtggaacactgggcttagcctctgtggctggaatg
tgtgagcctgaaaggagctgcagcattaatgaagacattggcctaggctcggcttttacc
atcgcacatgagattggtcacaattttggtatgaaccatgatggaattggaaattcttgt
gggacgaaaggtcatgaggcagcaaaacttatggcagctcatattactgcaaataccaat
cccttctcctggtctgcctgcagcagagactacatcaccagctttctagattcaggccgt
ggtacttgccttgataatgagcctccaaagcgtgactttctttatccagctgtggcccca
ggtcaggtgtatgatgctgatgaacaatgtcgtttccagtatggagcaacatcccgccaa
tgcaaatatggggaagtgtgtagagagctctggtgcctcagcaaaagcaaccgctgtgtc
accaacagtattccagctgctgaggggacactgtgtcagactgggaatattgagaaaggg
tggtgttatcagggagattgtgttccttttggcacatggccccagagtattgatgggggc
tggggttcctggtcactgtggggcgagtgcagtaggacctgcggaggaggtgtctcctcg
tctctaagacactgtgacagtccagcaccttcaggaggtgggaaatattgccttggtgaa
aggaaacgctaccgctcttgcaacacagatccatgccctttgggttcccgagattttcga
gaaaaacagtgtgcagactttgacagtatgcctttccggggaaagcattataactggaaa
ccctatactggaggtggggtaaaaccttgtgcattaaattgcctggctgaaggctataat
ttctacacagagcgagctcctgctgtgatagatgggacacagtgcaatgcagactcactg
gatatctgtatcaatggagaatgcaagcacgtaggttgtgataatattttgggatctgat
gctagggaagataggtgccgagtctgtggtggggatggaagcacctgtgatgccattgaa
gggttcttcaatgactcattgcccagaggaggttatatggaagtggttcagataccaaga
ggctctgttcatattgaagtaagagaagtttccatgtcaaaaaattacattgctttaaaa
tctgaaggggatgattactacattaatggtgcctggactattgactggcctaggaaattt
gatgtttcggggacagcttttcactacaagagaccgacagatgaaccagaatccttggaa
gctctaggacccacctctgagaacctcattgtaatggttctactccaagaacagaatttg
ggaattaggtacaagttcaatgttcccatcgttcgtactggcagtggagataatgaagtt
ggcttcatgtggacttatcagccctgggcggagtgctctgctacttgtgctggaggtgtc
caaagacaagaagtggtctgtaaaagattggatgacaactccattgtccagaacaatttc
tgtgatcctgacagtaagccacctgaaaatcaaagagcctgcaacactgagccttgccca
cctgaatggttcattggagactggttggagtgcagcaagacttgtgatggtgggatgcgc
acaagggccgtgctctgcatcaggaaagttggaccttctgaagaggaaacactggactac
ggcgactgcttaacacaccggcctgtggagaaagagtcctgcaacaaccagtcatgtcca
cctcagtgggtagctttggactggtccgaatgtactcctaaatgtggttcaggattcaag
catcggattgttctgtgcaagagcagtgacctttctaaaacattcccagctgcacaatgt
ccagaggagagcaagcctcctgctcgcatccgctgcagtctgggccgctgccctcctccc
cgctgggtgacaggagactggggccagtgctctgctcagtgtggtcttggacaacaaatg
agaactgtccagtgcctttcctatactggacaggcgtctgttgactgtccagaaactgtc
cggcctccatccatgcagcagtgtgacagcaaatgtgatagcacccctctctccagtact
gaagagtgcaaagatgtgaacaaagtggcttattgcccactggtgctgaagttcaagttc
tgcagtcgagcatacttcagacagatgtgttgtaagacctgccaaggacactga

DBGET integrated database retrieval system