KEGG   Mus musculus (mouse): 108156Help
Entry
108156            CDS       T01002                                 

Gene name
Mthfd1, Dcs, E430024A07Rik, Mthfd
Definition
(RefSeq) methylenetetrahydrofolate dehydrogenase (NADP+ dependent), methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthase
  KO
K00288  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase / formyltetrahydrofolate synthetase [EC:1.5.1.5 3.5.4.9 6.3.4.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00670  One carbon pool by folate
mmu01100  Metabolic pathways
Module
mmu_M00141  C1-unit interconversion, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    108156 (Mthfd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    108156 (Mthfd1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     108156 (Mthfd1)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     108156 (Mthfd1)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     108156 (Mthfd1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108156 (Mthfd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FTHFS THF_DHG_CYH_C THF_DHG_CYH
Motif
Other DBs
NCBI-GeneID: 108156
NCBI-ProteinID: NP_620084
MGI: 1342005
Ensembl: ENSMUSG00000021048
UniProt: Q922D8 Q8BXX7 Q3TW74
Position
12; 12 C3
AA seq 935 aa AA seqDB search
MAPAGILNGKLVSAQIRDRLKNQVTRMQEQVPGFTPGLAILQVGDRDDSNLYINVKLKAA
EEIGIKATHIKLPRTSTESEVLKYVISLNEDASVHGFIVQLPLDSENSINTEAVINAIAP
EKDVDGLTSVSAGKLARGDLNDCFIPCTPKGCLELIKEAGVQIAGRHAVVVGRSKIVGAP
MHDLLLWNNATVTTCHSKTANLDKEVNKGDILVVATGQPEMVKGEWIKPGAVVIDCGINY
VPDDTKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAQRFLQKFKP
GKWTIQYNKLNLKTPVPSDIAISRSCKPKLIGNLAREIGLLTEEVELYGETKAKVLLSAL
DRLKHQPDGKYVVVTGITPTPLGEGKSTTTIGLVQALGAHLRQNVFACVRQPSQGPTFGI
KGGAAGGGYSQVIPMEEFNLHLTGDIHAITAANNLVAAAIDARIFHELTQTDKALFNRLV
PSVNGIRKFSDIQIRRLRRLGIEKTDPTTLTDDEINRFARLDIDPETITWQRVLDTNDRF
LRKITIGQSPTEKGHTRTAQFDISVASEIMAVLALTSSLEDMRERLGRMVVASSKKGEPI
SCEDLGVSGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSIIADRIALKLVG
PEGFVVTEAGFGADIGMEKFFNIKCRYSGLQPHVVVLVATVRALKMHGGGPTVTAGLPLP
KAYTEEDLDLVEKGFSNLRKQIENARMFGVPVVVAVNVFKTDTDAELDLVSRLSREHGAF
DAVKCTHWAEGGQGALALAQAVQRASQAPSSFQLLYDLKLSIEDKIRIIAQRIYGADDIE
LLPEAQNKAEIYTKQGFGNLPICMAKTHLSLSHNPEQKGVPTGFVLPIRDIRASVGAGFL
YPLVGTMSTMPGLPTRPCFYDIDLDPETEQVNGLF
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggcaccagcgggaatcctgaacgggaaactggtttctgcgcaaatcagggatcgactg
aagaaccaggtaactcggatgcaggagcaggtacctggcttcacccctggcctggcaatc
ctgcaggttggcgacagagatgattccaatctttatataaatgtgaagctgaaggctgct
gaagagattgggatcaaagccactcacattaaattaccaagaacatccacagagtccgag
gtgttaaaatatgtcatctccctgaacgaggatgcctctgtgcacggattcatagtgcag
ctgcctttagattcagagaattccattaacactgaggcagtcatcaatgccattgcaccc
gagaaggatgtggatgggttgacgagcgtcagtgctgggaagctcgccagaggtgatcta
aatgactgcttcatcccatgcacacccaagggatgcttggaactcatcaaagaggcaggg
gtgcagattgccggaaggcacgcggtggtggttggtcgaagtaagatagttggtgcaccc
atgcatgacctccttctgtggaacaatgccacggtgaccacctgccactccaagactgcc
aatctggacaaggaggtaaataaaggagacattctggtggttgccacaggccagcctgag
atggtgaagggggagtggatcaagcctggggctgtggtcatagactgtgggatcaattat
gttccagatgatacaaaaccaaatggaaggaaagtcgtgggtgatgtggcctacgatgag
gccaaggagagggcgagctttatcacgcctgtccctggtggcgtggggcccatgaccgtg
gcaatgctgatgcagagcacagtagagagcgcacagcgcttcctacagaaatttaagcca
gggaagtggacaattcagtataacaagctgaacctcaagactcctgtcccaagtgacatt
gctatatcacgatcttgcaaaccaaagctcatcgggaacctggcccgagaaatcgggctg
ctcaccgaagaggtggagttgtacggggaaacgaaggctaaagtcttgctgtcagcatta
gatcgcctgaagcatcagccagatgggaaatatgtcgtggtgactggaattactccaaca
ccgctgggagaagggaagagtaccaccacgatcgggctggtgcaggccctcggcgcccac
ctgcgacagaacgtctttgcatgtgtgcgacagccttcgcagggccccacctttgggata
aaaggtggcgctgcaggaggcggctattcccaggtcattcctatggaagagtttaacctc
cacctcactggtgacatccacgccatcactgctgctaacaacctcgtggctgctgccatt
gatgctcggatatttcatgagctgacccagacagacaaggctctctttaatcgtctggta
ccttcagtaaacggaataagaaaattctctgacatccaaatccgcaggttacggaggcta
ggcattgagaagactgaccccaccacgctgacagatgacgagataaacagatttgcaaga
ctggatattgacccagaaaccataacatggcagagagtgttggacaccaacgatagattc
ctgaggaagatcacaattggacagtctccaacagagaaaggccacacacgcacggcccag
tttgatatctctgtggccagtgagatcatggcagtcctggccctcacgagctctctggaa
gacatgagagagagactgggcagaatggtggtagcgtccagtaagaaaggggagcctatc
agttgcgaagacctgggcgtgagtggggcgctgacggtgctgatgaaggatgcaatcaag
cccaacctcatgcagaccttagagggcacgccagtgtttgtccatgccgggcctttcgcc
aacattgcacacgggaattcctccatcattgcagaccggattgcactcaagctggtaggc
cctgagggcttcgtagtaacggaagctggattcggagcagacataggaatggaaaagttc
ttcaacatcaagtgccggtattctggtctccagccacacgtggtggttctggttgccact
gtcagggcccttaagatgcacgggggtggccccacggtcaccgctggactgcctcttccc
aaggcttacacagaagaggacctggacctggttgaaaagggcttcagtaacttgaggaaa
caaatcgaaaatgctagaatgtttggagtccctgtcgtcgtggctgtgaacgtgttcaag
acagatacagatgctgagctggaccttgtcagccgcctctccagagaacacggggctttt
gatgctgtcaagtgcacccactgggcagaagggggccagggggccttggccctggctcag
gctgtccagagagcgtcacaggcccccagcagcttccagctcctctatgacctcaagctc
tcaattgaggataaaatcaggattattgcacagaggatctacggggccgatgacatcgaa
ttgctcccggaagcacagaacaaagcagaaatttacacaaagcagggctttgggaatcta
cccatctgcatggccaaaacacacttgtccttgtctcacaacccagagcaaaaaggggtg
cctactggtttcgttctgcccatccgggacatccgtgccagcgttggggcaggtttcctg
tatcctttagtaggaacgatgagcacaatgcctggactccctacgcggccctgtttttat
gatattgatttggatcctgaaacggaacaagtgaatggattgttttaa

DBGET integrated database retrieval system