KEGG   Mus musculus (house mouse): 108159
Entry
108159            CDS       T01002                                 
Symbol
Ubxn8, D0H8S2298E, Rep-8, Rep8h, Ubxd6
Name
(RefSeq) UBX domain protein 8
  KO
K24351  UBX domain-containing protein 8
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108159 (Ubxn8)
SSDB
Motif
Pfam: UBX EMC3_TMCO1 TetR_C_21
Other DBs
NCBI-GeneID: 108159
NCBI-ProteinID: NP_848763
MGI: 1337129
Ensembl: ENSMUSG00000052906
UniProt: Q3TTF2
Position
8:complement(34109614..34135515)
AA seq 277 aa
MASRGVVGLFLLSALPLLCLELRRGIPSLGIKDLILLSGRIFLLLALLTLVISVTTSWFN
SLKPSQGHLKEGEKENEKRRRLVRERQQEAQGEKASRYIENVLKPQQEMKLKKLEERFYQ
MTGETWKLTAGHRLLEGDEDSEFENSSQASFETINGEAARRQNLPKFSTEISPAARPLLR
KEVPDLPEEPSETAEEVVTVALRCPNGRVLRRRFFKSWNSQVLLDWMMKVGYHKSLYRLS
NSFPRRALEVEGGSSLEDIGITVDTVLNVEEKEQSSQ
NT seq 834 nt   +upstreamnt  +downstreamnt
atggcttctcgtggcgtcgtgggccttttcttgctctctgctctccctctcttgtgtctg
gagctccggcgcgggatcccgagtctcggcattaaagatctcattttgctgagtggccgg
atattcctactgctggccctgcttaccttagtcatttccgtgaccacctcctggtttaac
tcactgaaaccttcgcaaggtcatctgaaagaaggagaaaaagagaatgagaaaagacgg
agactcgtgagggaaaggcaacaggaagcccagggtgagaaggccagcagatatatagag
aatgttttaaagcctcagcaggaaatgaagttgaaaaaactggaggagcggttttatcag
atgacaggggagacctggaagctgaccgctggccaccgactcctagagggggatgaagat
tcggagtttgaaaattcaagtcaggcatcttttgaaacaataaacggagaggcagcaaga
agacagaacttgcctaagttttcaactgaaatttcaccagctgctcggccgctcctgagg
aaggaggttcctgatttacctgaagaaccatcagaaacagctgaagaggtagttactgtt
gcccttcgatgcccaaatggacgtgttctgaggagaagatttttcaagtcgtggaattca
caggtcttacttgactggatgatgaaagttgggtaccacaaatccctatatagactttcc
aattcctttcccagaagggccctggaagtggagggaggctcgtcactggaggacatagga
ataactgtggacactgtacttaacgtggaagagaaagagcagagcagccagtag

DBGET integrated database retrieval system