KEGG   Mus musculus (mouse): 108159
Entry
108159            CDS       T01002                                 

Gene name
Ubxn8, D0H8S2298, D0H8S2298E, Rep, Rep-8, Rep8h, Ubxd6
Definition
(RefSeq) UBX domain protein 8
  KO
K24351  UBX domain-containing protein 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108159 (Ubxn8)
SSDB
Motif
Pfam: UBX EMC3_TMCO1 TetR_C_21 SDF
Other DBs
NCBI-GeneID: 108159
NCBI-ProteinID: NP_848763
MGI: 1337129
Ensembl: ENSMUSG00000052906
Vega: OTTMUSG00000060961
UniProt: Q3TTF2
Structure
PDB: 
2CR5

Position
8; 8 A4
AA seq 277 aa
MASRGVVGLFLLSALPLLCLELRRGIPSLGIKDLILLSGRIFLLLALLTLVISVTTSWFN
SLKPSQGHLKEGEKENEKRRRLVRERQQEAQGEKASRYIENVLKPQQEMKLKKLEERFYQ
MTGETWKLTAGHRLLEGDEDSEFENSSQASFETINGEAARRQNLPKFSTEISPAARPLLR
KEVPDLPEEPSETAEEVVTVALRCPNGRVLRRRFFKSWNSQVLLDWMMKVGYHKSLYRLS
NSFPRRALEVEGGSSLEDIGITVDTVLNVEEKEQSSQ
NT seq 834 nt   +upstreamnt  +downstreamnt
atggcttctcgtggcgtcgtgggccttttcttgctctctgctctccctctcttgtgtctg
gagctccggcgcgggatcccgagtctcggcattaaagatctcattttgctgagtggccgg
atattcctactgctggccctgcttaccttagtcatttccgtgaccacctcctggtttaac
tcactgaaaccttcgcaaggtcatctgaaagaaggagaaaaagagaatgagaaaagacgg
agactcgtgagggaaaggcaacaggaagcccagggtgagaaggccagcagatatatagag
aatgttttaaagcctcagcaggaaatgaagttgaaaaaactggaggagcggttttatcag
atgacaggggagacctggaagctgaccgctggccaccgactcctagagggggatgaagat
tcggagtttgaaaattcaagtcaggcatcttttgaaacaataaacggagaggcagcaaga
agacagaacttgcctaagttttcaactgaaatttcaccagctgctcggccgctcctgagg
aaggaggttcctgatttacctgaagaaccatcagaaacagctgaagaggtagttactgtt
gcccttcgatgcccaaatggacgtgttctgaggagaagatttttcaagtcgtggaattca
caggtcttacttgactggatgatgaaagttgggtaccacaaatccctatatagactttcc
aattcctttcccagaagggccctggaagtggagggaggctcgtcactggaggacatagga
ataactgtggacactgtacttaacgtggaagagaaagagcagagcagccagtag

KEGG   Mus musculus (mouse): 217379
Entry
217379            CDS       T01002                                 

Gene name
Ubxn2a, 6330407P03Rik, Ubxd4
Definition
(RefSeq) UBX domain protein 2A
  KO
K24349  UBX domain-containing protein 2A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    217379 (Ubxn2a)
SSDB
Motif
Pfam: SEP UBX
Other DBs
NCBI-GeneID: 217379
NCBI-ProteinID: NP_663416
MGI: 2442310
Ensembl: ENSMUSG00000020634
Vega: OTTMUSG00000033224
UniProt: Q99KJ0
Position
12; 12 A1.1
AA seq 258 aa
MKEVDNLDSIKEEWACETGPPDSQPLNDNQQKDCEYFVDSLFEEAGKAGAKCLSPTEQKK
QVDVNIKLWKNGFTVNDDFRSYSDGASQQFLNSIKKGELPSELWGIFDKEEVDVKVEDKK
NEVCMSTKPVFQPFSGQGHRLGSATPRIVSKAKSVEVDNKSTLSAVSLNNLEPITRIQIW
LANGERTVQRFNVSHRVSHIKDFIEKYQGSQRSPPFALATALPFLRFLDETLTLEEADLK
NAVIIQRLQKTAEPFRKL
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaaagaagtagataatcttgacagtataaaagaagaatgggcttgtgaaacaggacct
cctgacagtcaacccctcaatgataatcaacaaaaggactgtgaatattttgttgacagc
ctttttgaggaagcagggaaggctggtgccaaatgcttgtcccccactgaacagaagaaa
caggtagatgtaaatataaaattgtggaaaaacggattcactgtcaatgatgattttaga
agttactctgatggtgcaagtcagcagtttctgaactccatcaaaaagggggaattacct
tcagaattatggggaatttttgataaagaggaggtggatgttaaagttgaagataagaaa
aatgaagtatgtatgtctacaaagcctgtgttccagcccttctcaggacagggccacaga
ctaggaagtgctacaccaagaatcgtttctaaagcaaagagtgttgaagttgacaataaa
agtactttgtctgctgtttcactgaacaacttggagcccattaccaggatccagatctgg
ttagccaatggggaaagaactgtccaaagatttaatgtttctcatagggtgagccacatc
aaagacttcattgaaaaataccaaggatctcagagaagccctccctttgccctggcaaca
gctcttcctttcctcaggtttctggatgaaacgctcacattggaagaagcagatttgaag
aatgctgtaatcattcagagactccaaaaaactgccgagccttttagaaaactttga

KEGG   Mus musculus (mouse): 225896
Entry
225896            CDS       T01002                                 

Gene name
Ubxn1, 2B28, 4930455J02Rik, D19Ertd721, D19Ertd721e, T25529, mY33K
Definition
(RefSeq) UBX domain protein 1
  KO
K24348  UBX domain-containing protein 1/4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    225896 (Ubxn1)
SSDB
Motif
Pfam: UBX UBA
Other DBs
NCBI-GeneID: 225896
NCBI-ProteinID: NP_666205
MGI: 1289301
Ensembl: ENSMUSG00000071655
UniProt: Q922Y1
Position
19; 19 A
AA seq 297 aa
MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLSHVL
GREPTPSEQVGPEGSGSAAGESRPILTEEERQEQTKRMLELVAQKQREREEREEREALER
EKQRRRQGQELSVARQKLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYG
GSVGSRSSPPATDPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVR
LYVELHRGEEPGQDQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKKCPS
NT seq 894 nt   +upstreamnt  +downstreamnt
atggcggagctgacggctctggagagcctcatcgagatgggctttcccaggggacgcgcg
gagaaggctctggccctcacagggaaccagggcatcgaggctgcgatggattggctgatg
gagcatgaagacgaccccgatgtggatgagcctctggagactcccctcagccatgtcctg
ggacgagaacccacgccctcagagcaagttggccctgaaggctctgggtctgctgctgga
gaaagcagacccattttgactgaagaggagagacaagaacagaccaagagaatgttggaa
cttgtggcacaaaagcagcgggaacgtgaagaaagagaggagcgagaagctttagaacga
gaaaagcagcggaggagacaagggcaagagctgtcagttgcacgacagaaactgcaggaa
gatgagatgcgccgggctgcggaggagcgcaggagggaaaaggctgaagagttagctgcc
agacaaagggttcgagaaaaaattgaaagggacaaagcagagagagccaagaagtatggt
ggtagtgtgggttctcggtcatccccaccagcaacagacccaggtcctgttccttcttct
cccagccaggagccccctactaagcgggagtatgaccagtgtcgtatacaggttaggctg
cctgatgggacttcactgacccagactttccgggcccgggaacagctggcagctgtgagg
ctctacgtggagcttcaccgtggggaggagcctggacaggaccaggaccctgtgcagttg
ctcagtggcttccccagacgggctttctcagaggctgatatggaacggcctctgcaggaa
ctgggactcgtgccttctgctgtcctcattgtggccaagaagtgtcccagctga

KEGG   Mus musculus (mouse): 386649
Entry
386649            CDS       T01002                                 

Gene name
Nsfl1c, Munc-18c, Stxbp3a, p4, p47
Definition
(RefSeq) NSFL1 (p97) cofactor (p47)
  KO
K14012  UBX domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    386649 (Nsfl1c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    386649 (Nsfl1c)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Others
    386649 (Nsfl1c)
SSDB
Motif
Pfam: SEP UBX UBA_4 TAP_C
Other DBs
NCBI-GeneID: 386649
NCBI-ProteinID: NP_001278003
MGI: 3042273
Ensembl: ENSMUSG00000027455
Vega: OTTMUSG00000015798
UniProt: Q9CZ44
Position
2; 2 G3
AA seq 370 aa
MAEERQDALREFVAVTGTEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSS
VSRGTAPSDNRVTSFRDLIHDQDEEEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVD
DLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGERRRHSGQDV
HVVLKLWKTGFSLDNGDLRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRD
EDFVKPKGAFKAFTGEGQKLGSTAPQVLNTSSPAQQAENEAKASSSILINEAEPTTNIQI
RLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELADENQTLKEANL
LNAVIVQRLT
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggcggaggagcggcaggacgcgttgagggagttcgtggcggtgactggcactgaggag
gacagggcccgtttcttcctggagtcggctggctgggacctgcagattgcacttgcaagc
ttttatgaggatggaggggatgaagacattgtgaccatttcacaagcaaccccaagttca
gtgtccagaggcacagctcctagtgataatagagtgacatccttcagagacctcattcat
gaccaagatgaagaggaggaggaagaggagggacagaggttttatgctgggggctcagag
agaagtggacagcagattgttggtcctccccggaagaaaagtcccaacgagctggtggat
gatctgtttaagggtgccaaagagcatggggctgtagctgtggaacgagtgaccaagagc
cctggagagaccagtaaaccgagaccatttgcaggagggggctaccgccttggagcagca
ccagaggaagagtctgcctatgtggcaggagaaaggaggcggcattcaggccaggatgtt
catgtagtgctaaagctctggaaaactggattcagcctagacaatggtgaccttagaagc
taccaagacccatccaatgcccagtttctggagtctatccgtagaggggaggttcctgca
gagcttcggaggttagcgcatggtgggcaggtgaacctggatatggaggatcatcgggat
gaggacttcgtgaagcccaagggagctttcaaagccttcactggcgagggccagaaactg
ggcagcacggccccccaggtattaaacaccagctctccagcccaacaagcagaaaatgaa
gccaaagctagctcgtccatcttaatcaatgaagcagaacctaccacgaacatccaaatc
cggcttgcagatggcgggaggctggtgcagaaattcaaccacagccacaggatcagcgac
atccggctcttcatcgtggatgcccggccagctatggctgccaccagttttgtccttatg
actaccttccctaacaaagagctggctgatgagaaccaaaccctgaaggaagccaacctt
ctcaacgctgtcatcgtgcagcggttaacataa

KEGG   Mus musculus (mouse): 66530
Entry
66530             CDS       T01002                                 

Gene name
Ubxn6, 1200008L11Rik, 2210415J11Rik, AU040909, Ubxd1, Ubxdc2
Definition
(RefSeq) UBX domain protein 6
  KO
K14011  UBX domain-containing protein 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    66530 (Ubxn6)
SSDB
Motif
Pfam: PUB UBX
Other DBs
NCBI-GeneID: 66530
NCBI-ProteinID: NP_077752
MGI: 1913780
Ensembl: ENSMUSG00000019578
Vega: OTTMUSG00000033034
UniProt: Q99PL6
Position
17; 17 D
AA seq 442 aa
MKKFFQEIKADIKFKSAGPGQKLTDSAGEKTTKGKSPQLALRQPRQGPTDEAQMAAAAAL
ARLEQKQPRARGPTSQDSIRNQVRKELQAEATSSNNPGAPGTNSVPEPKEEISPHLAVPG
VFFICPLTGVTLRRDQRDAHIKQAILSHFSTDPVAASIMKIHTFNRDRDRVKLGVDTIAK
YLDNIHLHPEEEKYQKIKLQNKVFQERINCLEGSHEFFEAIGFKKVTLPVPDQEGQEEFY
VLGEDARAQPQNLARHKQQLLDAEPVRATLDRQLRVFRPSALASHFELPSDFFSLTAEEV
KREQRLRTEAVERLSSLRTKAMREKEEQRELRKYTYALVRVRLPDGCLLQGTFYAREKLS
ALFRFVREALQNDWLPFELRASGGQKLEENEALALNECGLVPSALLTFSWDASVLEDIRA
AGAEPAKSVLRPELLAAIEQLS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgaagaagttcttccaggaaatcaaggctgacatcaagttcaagagcgcggggcccggc
cagaagcttacggattccgcaggggagaagaccaccaaaggaaagtcaccacagctggcc
ctccggcagccccgtcagggccccactgatgaggcacagatggctgccgctgctgccctg
gcccggctggaacagaaacagccccgagcccggggccctacatctcaggactccatccgg
aaccaggtgaggaaggaacttcaggccgaagccacctccagcaacaatccaggagctcct
gggaccaactcggtacctgagcccaaggaggaaatctctccccatttggcagtgcctggt
gtgttcttcatctgtccgctcacaggtgtcaccctgaggagggaccagcgggatgcccac
atcaagcaggccatcctgtcgcacttttccacagaccccgtggctgcctccatcatgaag
atacatacattcaatagagaccgggaccgagtgaagctgggtgtggatactatcgccaaa
tacctggacaacatccatttacacccagaggaagaaaaataccagaaaatcaaactgcag
aacaaggtgttccaggagcgcatcaactgtctcgagggaagccacgagttctttgaagcc
attggcttcaagaaggtcaccctacctgtgccggatcaggagggccaggaggagttctac
gttctgggtgaggatgcacgggcgcagccgcagaacctggcgcggcacaagcagcagctg
ttggatgccgagcctgtgcgggccactctggatcggcagctccgagtcttccgcccctcg
gctctggcctcacattttgaactcccctcagatttcttcagccttacagctgaggaggtg
aagcgggagcaaaggctcaggacagaggcggtggagcgactgagctcactcaggaccaaa
gccatgcgggagaaagaggagcagcgggagcttcgcaagtatacctatgcccttgtgcgc
gtgcgcctgccagatggctgtctactgcaagggaccttctatgcccgggagaagctatcc
gcgctcttccgatttgtgcgcgaggcgctacagaacgactggctgccctttgagctgagg
gcctccggtggacagaagctggaggagaacgaggccctggccttgaatgagtgtgggctg
gtaccctctgccctgttgaccttctcctgggatgcttcagtgttggaagatataagggca
gcaggagctgagccagcaaaatctgtcttgaggcctgagctgcttgcagccatcgagcaa
ctctcctga

KEGG   Mus musculus (mouse): 67812
Entry
67812             CDS       T01002                                 

Gene name
Ubxn4, 1300013G12Rik, Ubxd2, mKIAA0242
Definition
(RefSeq) UBX domain protein 4
  KO
K24348  UBX domain-containing protein 1/4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    67812 (Ubxn4)
SSDB
Motif
Pfam: UBX Thioredoxin_7 HAUS5
Other DBs
NCBI-GeneID: 67812
NCBI-ProteinID: NP_080666
MGI: 1915062
Ensembl: ENSMUSG00000026353
Vega: OTTMUSG00000049358
UniProt: Q8VCH8 A0A0R4J078
Structure
PDB: 
2DZK

Position
1; 1 E3
AA seq 506 aa
MLWFQGAIPAAIASAKRSGAVFVVFVAGDDEQSIQMAASWEDEKVTQASSNNFVAIKIDT
KSEACLQFSQIYPVVCVPSSFFIGDSGIPLEVIAGSVSADELVTRIHKVQQMHSSKGEAS
VTNDNQSESSVSTPSASFEPDVCENPESKNTELCETPATSDTKSDTATGGECTGHDSHSQ
EPHGCSNQRPAEDLTVRVERLTKKLEERREEKRKEEAQREIKKEIERRKTGKEMLDYKRK
QEEELTKRMLEERSREKAEDRAARERIKQQIALDRAERAARFAKTKEAEAAKAAALLTKQ
AGTEVKRESTARDRSTIARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNFSL
ATMFPRREFTREDYKRRLLDLELAPSASVVLLPAGRPATSIVHSSSGDIWTLLGTVLYPF
LAIWRLISNFLFSNPPPAQTSARATSTEPSNSASSSKSEKREPVRKRMLEKRGEDFKKEG
KIYRLRTQDDGEDENNTWNGNSTQQM
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgctgtggttccagggcgccatcccggcggccatcgcgtctgctaagaggagcggcgcg
gtcttcgtggtgttcgtggcaggggatgatgagcaatctatacaaatggctgcaagttgg
gaagatgaaaaagtgacacaagcatcatcaaacaactttgttgctattaaaattgatact
aaaagtgaagcctgtctgcagttttcacaaatttatcctgtagtatgtgttccatccagt
ttctttataggagacagtggaatccctttggaagtaatagcggggagtgtttctgcagat
gagcttgttacaagaattcataaagtccaacagatgcactcgtcaaaaggtgaagcatca
gtgacaaatgacaaccagtcagaaagttcagtatctaccccatctgcctcatttgaacct
gatgtatgtgaaaatcccgagtccaaaaatacagagctttgtgagacaccagctacctct
gacacaaagtcagatactgcaacaggaggagaatgcacaggtcatgacagccactctcag
gagcctcatggatgttcaaaccagagaccagccgaggacctcaccgtcagagtagaaaga
ctaacaaaaaaacttgaagaaaggagagaagagaagcggaaggaagaagcacagagagag
attaagaaggaaattgaaaggagaaaaactggaaaggaaatgttggattataaaagaaaa
caagaagaagaattaacaaaaagaatgttagaagaaagaagcagagagaaggcagaagat
agagcggctcgagagcgcatcaagcagcagattgccctggatcgtgcagaaagagctgct
cgttttgcaaagacaaaggaagcagaagctgccaaagctgctgccttgctgaccaaacag
gcaggaacggaagtcaagagagagtctacagcacgagacagaagcaccattgcaagaatt
cagttccggctgcctgatggttcttcctttacaaaccagtttccttctgatgctcctcta
gaagaagcgaggcagtttgctgcacagaccgtgggcaacacctatggcaatttttcatta
gccaccatgtttcccagaagagagttcaccagagaagactataagaggaggctgctggat
ctggagctcgcccccagcgcctctgtggtgctgctgccagcaggacggccagccacatcc
attgtccactcttctagtggagacatttggacattactggggacggtgctttatccattc
ctggccatatggagattaattagcaattttttatttagcaatcctcctcctgcacagact
tcagcaagagccacatccacagagccttcaaactctgcatcatccagcaaatcagagaaa
agggaaccagtccgaaaaagaatgctggaaaaacgaggggaagactttaaaaaagaaggg
aaaatatacagactgaggactcaagatgacggtgaagacgagaacaacacttggaatgga
aactccacgcagcagatgtag

DBGET integrated database retrieval system