KEGG   Mus musculus (mouse): 108160
Entry
108160            CDS       T01002                                 

Symbol
Fam50a, D0HXS9928, D0HXS9928E, XAP, XAP-5
Name
(RefSeq) family with sequence similarity 50, member A
  KO
K13119  protein FAM50
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    108160 (Fam50a)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   Complex C specific factors
    108160 (Fam50a)
SSDB
Motif
Pfam: XAP5
Other DBs
NCBI-GeneID: 108160
NCBI-ProteinID: NP_613073
MGI: 1351626
Ensembl: ENSMUSG00000001962
Vega: OTTMUSG00000017658
UniProt: Q9WV03 A0A158SIT3
Position
X; X A7.3
AA seq 339 aa
MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAEL
KSSTVGLVTLNDMKAKQEALVKEREKQLAKKEQSKELQLKLEKLREKERKKEAKRKISSL
SFTLEEEEEGVEEEEEMAMYEEELEREEITTKKKKLGKNPDVDTSFLPDRDREEEENRLR
EELRQEWEAKQEKIKSEEIEITFSYWDGSGHRRTVKMKKGNTMQQFLQKALEILRKDFSE
LRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKDE
SHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcccagtacaagggcgctgcaagcgaggcgggacgcgccatgcacctaatgaagaag
agggagaagcagcgtgagcaaatggagcagatgaagcagaggattgcagaggagaacata
atgaaatctaacattgacaagaaattctctgcacactatgatgctgtggaagcagagctc
aagtccagtactgtgggtcttgtgactctgaatgacatgaaggccaaacaggaggcactg
gtgaaggagcgagagaaacagctggcaaaaaaggagcagtcaaaggagctacagctgaaa
ctagagaagcttcgagagaaggagcgcaagaaggaggccaagcggaagatctccagcctg
tccttcaccttggaggaagaggaggagggagttgaagaggaggaagagatggctatgtac
gaggaggaactggagagggaagagatcaccacaaagaaaaagaaattggggaagaaccct
gatgtggacacaagcttcttgcctgaccgggaccgggaggaggaggagaatcggcttcgg
gaagagctgcgccaggagtgggaagccaagcaggaaaaaatcaagagtgaagagattgaa
atcacctttagttactgggatggctctgggcaccggcgcacagttaagatgaagaaaggc
aacacgatgcagcagttcctacagaaagcactagagatcttgcggaaagacttcagtgaa
ctcaggtcagcaggggtggaacagctcatgtacatcaaggaggatttaatcatcccccat
catcacagcttctatgacttcatcgttaccaaggcacgaggaaaaagtgggccactcttc
aacttcgacgttcatgatgatgtacgactgctcagtgatgccactgtggagaaggatgag
tcacatgcaggcaaagtagtgctaaggagctggtatgagaagaacaagcacatttttcct
gccagtcgctgggagccctatgacccagaaaagaaatgggacaagtacacgatccggtga

DBGET integrated database retrieval system