KEGG   Mus musculus (mouse): 108645
Entry
108645            CDS       T01002                                 

Gene name
Mat2b, 1110064C04Rik, 2410018D16Rik, AI182287, AU022853, MAT-II, MATIIbeta, TGR
Definition
(RefSeq) methionine adenosyltransferase II, beta
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00270  Cysteine and methionine metabolism
mmu01100  Metabolic pathways
mmu01230  Biosynthesis of amino acids
Module
mmu_M00034  Methionine salvage pathway
mmu_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    108645 (Mat2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     108645 (Mat2b)
SSDB
Motif
Pfam: RmlD_sub_bind Epimerase GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_4 DapB_N
Other DBs
NCBI-GeneID: 108645
NCBI-ProteinID: NP_598778
MGI: 1913667
Ensembl: ENSMUSG00000042032
Vega: OTTMUSG00000005433
UniProt: Q99LB6
Position
11; 11 A5
AA seq 334 aa
MVGREKELSIHFVPGCCQLVEEEVNIPSRRVLITGATGLLGRAVYKEFQQSNWHTVGCGF
RRARPKFEQVNLLDSEAVHHLIHDFQPHVIVHCAAERRPDVVESQPDAASQLNVGASGNL
AKEAAAIGAFLIYISSDYVFDGTNPPYTEEDIPSPLNLYGKTKLDGEKAVLENNLGAAVL
RIPVLYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVASVCRQLAEKRML
DPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVIGAQRPKNAQLDCSKL
ETLGIGQRTPFRTGIKESLWPFLIDKRWRQTVFH
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggtgggccgggagaaggagctctccatccacttcgtccccggctgctgccagctggtg
gaggaggaagtgaacatccctagccggcgggttctcattactggtgccactgggcttctt
ggcagagcagtttacaaagagtttcagcagagcaactggcacaccgttggctgtggcttt
cgaagagcaagaccaaaattcgaacaagtgaacctgttggattctgaagctgttcatcac
ctcattcatgatttccagcctcatgtcatagtgcattgtgctgcagagagaagacctgat
gttgttgagagtcagccagatgctgcttcccagctgaatgtgggtgcctctgggaacttg
gcaaaggaggcagctgcgattggagcatttctcatctacattagctcagattatgtgttt
gatggcacaaatcccccttacacagaagaagatataccaagtcccctgaatctatatgga
aaaacaaaattagatggagaaaaagcagtcctggagaataatttaggggctgctgtgttg
agaattcctgttctgtatggggaagttgaaaagcttgaagaaagtgctgtgactgttatg
ttcgacaaggtgcagttcagcaacaagtcagcaaacatggaccattggcagcagaggttc
cccacacatgtgaaagacgtagccagtgtgtgccggcagctggcagagaagaggatgctg
gatccatccattaagggaacctttcactggtctggcaatgagcagatgaccaagtatgaa
atggcgtgtgcaattgcagatgccttcaacctccccagcagccacttaagacctattact
gacagtcctgtcataggagcacagcgccccaaaaatgctcagctcgattgctccaaattg
gagacgttgggcattggccagaggacaccatttcgaactggaatcaaagaatctctctgg
cctttcctcatcgacaagagatggagacagactgtctttcattag

DBGET integrated database retrieval system